PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02876.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family VOZ
Protein Properties Length: 204aa    MW: 23369.7 Da    PI: 10.2203
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02876.1_g00005.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ291.58.2e-902217364215
                      VOZ  64 aalsakvqgkevgipecegaatakspwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefg 149
                              +a++ak+ gk vgip+cega+++k+pwnaaelf+l+l+egetirewlffdkprra++sgnrkqrslpdysgrgwhesrkq+mke++
  Rsa1.0_02876.1_g00005.1  22 HAVRAKTLGKVVGIPVCEGAVNTKCPWNAAELFHLELVEGETIREWLFFDKPRRAYDSGNRKQRSLPDYSGRGWHESRKQLMKEQA 107
                              599*********************************************************************************** PP

                      VOZ 150 glkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksakgkvskdsladlqkklgrl 215
                              g+krsyymdpqp++ fewhl+ey+ine+d +alyrlelkl+++kks+kg+v+kd+l+dlqkk+ ++
  Rsa1.0_02876.1_g00005.1 108 GQKRSYYMDPQPPGLFEWHLFEYQINESDVCALYRLELKLTNGKKSPKGRVAKDPLVDLQKKMEKM 173
                              **************************************************************9886 PP

Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MQLQERFSHL QAARKEGRLG DHAVRAKTLG KVVGIPVCEG AVNTKCPWNA AELFHLELVE  60
GETIREWLFF DKPRRAYDSG NRKQRSLPDY SGRGWHESRK QLMKEQAGQK RSYYMDPQPP  120
GLFEWHLFEY QINESDVCAL YRLELKLTNG KKSPKGRVAK DPLVDLQKKM EKMGQLTPEG  180
ASDKPSPPTK GRTKATKERT KSTN
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ1 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Binds as a dimer to the palindromic sequence 5'-GCGTNNNNNNNACGC-3'. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_02876.1_g00005.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. Down-regulated by far-red light (at protein level). {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018479977.11e-152PREDICTED: transcription factor VOZ2-like
SwissprotQ9SLB91e-105VOZ2_ARATH; Transcription factor VOZ2
TrEMBLA0A0D3C5T61e-120A0A0D3C5T6_BRAOL; Uncharacterized protein
STRINGBo4g191510.11e-120(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM110602534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42400.11e-107vascular plant one zinc finger protein 2
Publications ? help Back to Top
  1. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  2. Koguchi M,Yamasaki K,Hirano T,Sato MH
    Vascular plant one-zinc-finger protein 2 is localized both to the nucleus and stress granules under heat stress in Arabidopsis.
    Plant Signal Behav, 2017. 12(3): p. e1295907
    [PMID:28277968]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]