PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02766.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WRKY
Protein Properties Length: 477aa    MW: 52096.6 Da    PI: 8.209
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02766.1_g00006.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.23.4e-33225281259
                              --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                     WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                              dDgynWrKYGqK+vkgs+fprsYY+Ct + Cpvkkkvers  d++v+ei+Y+g+H he
  Rsa1.0_02766.1_g00006.1 225 DDGYNWRKYGQKQVKGSDFPRSYYKCTNPACPVKKKVERSV-DGQVTEIIYKGQHSHE 281
                              8****************************************.***************8 PP

2WRKY105.52.7e-33380438159
                              ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                     WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                              ldDgy+WrKYGqK+vkg+++prsYY+Ct+agC v+k+ver+a+dpk+v++tYeg+Hnh+
  Rsa1.0_02766.1_g00006.1 380 LDDGYRWRKYGQKVVKGNPYPRSYYKCTTAGCGVRKHVERAANDPKAVVTTYEGKHNHD 438
                              59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.5E-28218283IPR003657WRKY domain
PROSITE profilePS5081123.491219283IPR003657WRKY domain
SuperFamilySSF1182903.66E-25222283IPR003657WRKY domain
SMARTSM007748.3E-36224282IPR003657WRKY domain
PfamPF031063.7E-25225280IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.4E-36365440IPR003657WRKY domain
SuperFamilySSF1182901.11E-29372440IPR003657WRKY domain
PROSITE profilePS5081138.388375440IPR003657WRKY domain
SMARTSM007741.9E-38380439IPR003657WRKY domain
PfamPF031063.8E-26381438IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MAGKEEEEQQ KQQKSSTGVA SRPTISLPPR PFGEMFYSGG VGFSGFSPGP MTLVSNMFSD  60
PNEFKSFSQL LAGAMASPAA AAAVGAGAHQ TPVSSVGGGG DSLLDPRFKQ NRPTGLMTTQ  120
PPAMFQVPPG LSPATLLDSP SFFGLFSPIQ GSFGMMTHQQ ALAQVTAQAV QGNNSAQIQS  180
ESSTQQQQTS MTEVPSLPAP AQRDDSEVSV YEHRPQPQHA DKPADDGYNW RKYGQKQVKG  240
SDFPRSYYKC TNPACPVKKK VERSVDGQVT EIIYKGQHSH EPPQNSKRGR DINGSCNSLN  300
KSKRDQETSQ VTTTEQISEA SDSEEVGNVE TSLGGTHEED EPDPKRRNTE VRVSEPVSST  360
NRTVTEPRII VQTRSEVDLL DDGYRWRKYG QKVVKGNPYP RSYYKCTTAG CGVRKHVERA  420
ANDPKAVVTT YEGKHNHDVP AGRTSSHQLR PNNNPSTVNL NQQQTVARLR LKEEQIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-42225441878Probable WRKY transcription factor 4
2lex_A1e-42225441878Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_02766.1_g00006.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salicylic acid and during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4300270.0KF430027.1 Brassica rapa WRKY transcription factor 3 (WRKY3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018441452.10.0PREDICTED: probable WRKY transcription factor 3
SwissprotQ9ZQ700.0WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLM4ECP40.0M4ECP4_BRARP; Uncharacterized protein
TrEMBLV5RGZ40.0V5RGZ4_BRACM; WRKY transcription factor 3
STRINGBra026554.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15342792
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.10.0WRKY DNA-binding protein 3
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Aamir M, et al.
    Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach.
    Front Plant Sci, 2017. 8: p. 819
    [PMID:28611792]