PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02672.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WRKY
Protein Properties Length: 480aa    MW: 51999.5 Da    PI: 8.2148
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02672.1_g00006.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1092.2e-34218274259
                              --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                     WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                              dDgynWrKYGqK+vkgsefprsYY+Ct +gCpvkkkvers  d++v+ei+Y+g+Hnhe
  Rsa1.0_02672.1_g00006.1 218 DDGYNWRKYGQKQVKGSEFPRSYYKCTNPGCPVKKKVERSL-DGQVTEIIYKGQHNHE 274
                              8****************************************.***************8 PP

2WRKY105.52.8e-33377435159
                              ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                     WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                              ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC v+k+ver+a+dpk+v++tYeg+Hnh+
  Rsa1.0_02672.1_g00006.1 377 LDDGYRWRKYGQKVVKGNPYPRSYYKCTTQGCGVRKHVERAATDPKAVVTTYEGKHNHD 435
                              59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.9E-30209276IPR003657WRKY domain
SuperFamilySSF1182902.48E-26216276IPR003657WRKY domain
SMARTSM007746.6E-39217275IPR003657WRKY domain
PROSITE profilePS5081124.857218276IPR003657WRKY domain
PfamPF031062.0E-26218274IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.0E-36363437IPR003657WRKY domain
SuperFamilySSF1182901.31E-29369437IPR003657WRKY domain
PROSITE profilePS5081138.044372437IPR003657WRKY domain
SMARTSM007743.2E-39377436IPR003657WRKY domain
PfamPF031065.5E-26378435IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 480 aa     Download sequence    Send to blast
MSEKEELPST SKSAGALSRP TLSLPPRPFS EMFVYGGGVG FSPGPMTLVS NMFSDTDESS  60
RSFSQLLAGV VMPSPAAGSE GNNNSNSSSS GVVDVVDPRF KQSRPAGLMV SQSPSMFTAP  120
PGLSPAMRLD SPSFLGLFSP LQGSYGMTHQ QALAQVTAQA VQANAINMQQ PQTDENPPSS  180
QALQSFSSDQ AQNPTSDHIT IIEQRLSQRP LNVDRPADDG YNWRKYGQKQ VKGSEFPRSY  240
YKCTNPGCPV KKKVERSLDG QVTEIIYKGQ HNHEPPQNTK RGNNKDSTAN LNGSSVNNKT  300
TREQHEAASQ ATTEQMSEAS DSEEVGNGES GVRDEPDAKR RSTDVRVLEQ AAAVAASHRT  360
VAEPRIIVQT TSEVDLLDDG YRWRKYGQKV VKGNPYPRSY YKCTTQGCGV RKHVERAATD  420
PKAVVTTYEG KHNHDPPAAK SSSHAATAAA AQLRHGGLAN LNQQHQQPVA CLRLKEEQTI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-44218438878Probable WRKY transcription factor 4
2lex_A7e-44218438878Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Has a positive role in resistance to necrotrophic pathogens (e.g. Botrytis cinerea), but a negative effect on plant resistance to biotrophic pathogens (e.g. Pseudomonas syringae). {ECO:0000269|PubMed:18570649, ECO:0000269|PubMed:22219184}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_02672.1_g00006.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By biotic and abiotic stresses such as pathogen infection (e.g. Botrytis cinerea and Pseudomonas syringae), salicylic acid (SA), jasmonic acid (JA), ethylene (ACC), liquid infiltration or spraying, and strongly during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756, ECO:0000269|PubMed:18570649}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC2465670.0KC246567.1 Brassica napus WRKY transcription factor 4.1 (WRKY4.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013600595.10.0PREDICTED: probable WRKY transcription factor 4
SwissprotQ9XI900.0WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLA0A0A7RCL50.0A0A0A7RCL5_BRAOC; WRKY87 protein
STRINGBo8g065800.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15342792
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.10.0WRKY DNA-binding protein 4
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Aamir M, et al.
    Structural and Functional Insights into WRKY3 and WRKY4 Transcription Factors to Unravel the WRKY-DNA (W-Box) Complex Interaction in Tomato (Solanum lycopersicum L.). A Computational Approach.
    Front Plant Sci, 2017. 8: p. 819
    [PMID:28611792]