PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02657.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TCP
Protein Properties Length: 496aa    MW: 54691.6 Da    PI: 9.7721
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02657.1_g00006.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP114.11.9e-352613694115
                      TCP   4 kkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgk 89 
                               k++++++hTkv+gR+RR+R++a caar+F+L++eLG+++ ++ti WLl+ ++pai+e+tgt++++a ++   s + + + +++++
  Rsa1.0_02657.1_g00006.1 261 PKRPSKDRHTKVEGRGRRIRMPAGCAARIFQLTRELGHKSEGETIRWLLERSEPAIIEATGTGTIPAIAV---SVNGTLKIPTEPA 343
                              6899**********************************************************99999544...2222222223334 PP

                      TCP  90 aaksaakskksqksaasalnlakesr 115
                               + ++ +++ ++++ ++++++ + +r
  Rsa1.0_02657.1_g00006.1 344 PQFESDSGSGKRRRRNCTSEFVDVKR 369
                              44444456666666666666666554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136927.195265319IPR017887Transcription factor TCP subgroup
PfamPF036342.4E-28265340IPR005333Transcription factor, TCP
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0031347Biological Processregulation of defense response
Sequence ? help Back to Top
Protein Sequence    Length: 496 aa     Download sequence    Send to blast
MSENARRINI AGVTLLNPWR IRREETRRGG DSWPAHGQCR CHRSKKRSRR PPRQRLGASQ  60
SLDHQKSART ATPTYGYKGL SGSKRMDPSS RDSYIFIEVN SDPKETPIKA YRNLLRNTDA  120
ALNKESRAAG LAWTSTPSFP PITLQMDVNS MTRTINLVSK PMILHGVLSD IEFLSMLFDF  180
CFVSFNSREE NEFADSLSKV DFLGFFLGME SNLKDKEAMA RLSDPDPETN PGMLLKEEGD  240
DLNKQHEVGF LQPVTSSITA PKRPSKDRHT KVEGRGRRIR MPAGCAARIF QLTRELGHKS  300
EGETIRWLLE RSEPAIIEAT GTGTIPAIAV SVNGTLKIPT EPAPQFESDS GSGKRRRRNC  360
TSEFVDVKRR DSSVTSGLAP ITAPSYGVNL MNIVNTQNFV PFWQTGFVTG GPNQMGHMWA  420
IPTVAAPSFL NGGTRPVPSY VSNASDAKPQ MGTSGGGGDG PTQTLRDFSF ETYDKKELQF  480
LGGSGDNTSP SSCHET
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00007PBMTransfer from 495258Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_02657.1_g00006.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018447528.10.0PREDICTED: transcription factor TCP19
SwissprotQ9LT891e-118TCP19_ARATH; Transcription factor TCP19
TrEMBLA0A0D2ZSV21e-172A0A0D2ZSV2_BRAOL; Uncharacterized protein
TrEMBLA0A3P6D4A51e-172A0A3P6D4A5_BRAOL; Uncharacterized protein
STRINGBo00998s020.11e-173(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM125832530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51910.21e-116TCP family protein