PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02655.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NF-YA
Protein Properties Length: 294aa    MW: 32748.8 Da    PI: 9.3858
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02655.1_g00005.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA105.64.1e-33156212158
                CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                              +ep+YVNaKQyq+Il+RRq+Rak+e e kl +ksrkpylheSRh+hA+rRpRg+gGrF
  Rsa1.0_02655.1_g00005.1 156 QEPVYVNAKQYQAILRRRQARAKAELEMKL-IKSRKPYLHESRHQHAMRRPRGTGGRF 212
                              69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005214.2E-36154215IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.414155215IPR001289Nuclear transcription factor Y subunit A
PfamPF020456.9E-29157212IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.6E-24158180IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860160180IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.6E-24189212IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010262Biological Processsomatic embryogenesis
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0055046Biological Processmicrogametogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MHSKSDGGNH QIVSEAVHHH QTSSINSLNP WQRAAAACNA NSFVEEAEGD KSIAFESTTN  60
GSKSPPSNRD DNSNKESPQV TNSSPQQSAG DYSEKSQQLV VHHGITPPPH PQLGWTSSNP  120
YQDPYYAGMM GTYPLAYVPY GGMTHSRMPL PPEVAQEPVY VNAKQYQAIL RRRQARAKAE  180
LEMKLIKSRK PYLHESRHQH AMRRPRGTGG RFAKKTNTEA SQPKAREKSN GSRTQSPTSS  240
HSDQPEAWND EYRTQSEEMQ SSASKRREEA EDCSGQQWNS ISSNHPSQAR LAIK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-19156212258NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013697367.11e-175PREDICTED: nuclear transcription factor Y subunit A-9-like isoform X3
SwissprotQ945M91e-142NFYA9_ARATH; Nuclear transcription factor Y subunit A-9
TrEMBLA0A078F3V21e-173A0A078F3V2_BRANA; BnaC05g31370D protein
TrEMBLA0A0D3CHV51e-173A0A0D3CHV5_BRAOL; Uncharacterized protein
STRINGBra031242.1-P1e-166(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM132681829
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20910.11e-143nuclear factor Y, subunit A9