PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02567.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 674aa    MW: 73376.1 Da    PI: 6.9308
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02567.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.5e-093934301954
                              HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                 Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                              Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Rsa1.0_02567.1_g00002.1 393 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 430
                              554459******************************88 PP

2BELL123.58.8e-40252323172
                     BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                              erqe+q+kkakL s+l+eV++rY+qy++q+q+vissFe++ag+gsak+YtslAlk+iSr+FrcLk+aia+qi
  Rsa1.0_02567.1_g00002.1 252 ERQEIQMKKAKLSSMLHEVEQRYRQYHQQMQMVISSFEQAAGIGSAKSYTSLALKTISRQFRCLKEAIAGQI 323
                              79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.6E-78172321IPR006563POX domain
PfamPF075262.7E-47178320IPR006563POX domain
PROSITE profilePS5007112.26371434IPR001356Homeobox domain
SMARTSM003892.3E-9374438IPR001356Homeobox domain
CDDcd000863.02E-12374435No hitNo description
SuperFamilySSF466895.99E-17375441IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.0E-29377440IPR009057Homeodomain-like
PfamPF059202.8E-18391430IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 674 aa     Download sequence    Send to blast
MAAYFHGNPS EISAGPDGGL QTLILMNPTT YVQYAQQEDD SNNNNNSNNN ANNNNSFVFL  60
DSHAPPQNAS QQFVGIPLSG HEAASITAAD NISVLHGYPP RVQYSLYNSH QVDPTHQQAA  120
CETPRAQRGL SLSLSSQQQQ QQQHHTLHHV GFGSGPGEDM RVGPGSTGSG VTNGIANLVS  180
SKYLKAAQEL LDEVVNADSN DINTKSQLFS SKKGTSGTDN KAVGESSTGG GEGSGGGGEA  240
SGKRTVELGT AERQEIQMKK AKLSSMLHEV EQRYRQYHQQ MQMVISSFEQ AAGIGSAKSY  300
TSLALKTISR QFRCLKEAIA GQIKAANKSL GEEDSVSGVG RLEGSRLKFV DHHLRQQRAL  360
QQLGMIQHPT NNAWRPQRGL PERAVSVLRA WLFEHFLHPY PKDSDKHMLA KQTGLTRSQV  420
SNWFINARVR LWKPMVEEMY TEEMKEQGKN MGSMEKTPNF DQNNEDSASK STSNQEKSPM  480
GGGGADNYHL NTNHNGDLEG VTGMQGSPKR LRTSEETMMQ PINADFSSNE KLTMKILEER  540
QGLRSDGGYP FMGNFGQYQM DDMSRFDVAV SDQELLAQRY SGNNNGVSLT LGLPHCDSLS  600
STHHQGFMQT HHGIPIGRRV KIGETDDYGA AGLNGGGGSA TTVHSSAAAA AAYNGMNIQN  660
QKRYVAQLLP DFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A4e-17380437158Homeobox protein Meis1
4xrs_B4e-17380437158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009141537.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_009141536.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_009141535.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLM4DL960.0M4DL96_BRARP; Uncharacterized protein
STRINGBra017277.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50082650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.30.0BEL1-like homeodomain 1