PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02389.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 322aa    MW: 36679.7 Da    PI: 5.1947
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02389.1_g00007.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260122.81.8e-38101101101
                   DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqq 86 
                              aCaaCk++rr+Ca+dC+lapyfpaeqpk f+nvh+lFG++ ++k+l++l+e +r++am+s+++++ +r r+Pv+G++g+ ++lq  
  Rsa1.0_02389.1_g00007.1  10 ACAACKYQRRRCAADCPLAPYFPAEQPKLFQNVHRLFGVRSIVKILENLDEVQRPEAMKSIIFQSYVRDRNPVHGCLGITQQLQYM 95 
                              7************************************************************************************* PP

                   DUF260  87 leqlkaelallkeel 101
                              +  +++el++++++l
  Rsa1.0_02389.1_g00007.1  96 IWVAEEELKAVNSQL 110
                              *********999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.3049110IPR004883Lateral organ boundaries, LOB
PfamPF031955.3E-3510107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MTLKGGTSGA CAACKYQRRR CAADCPLAPY FPAEQPKLFQ NVHRLFGVRS IVKILENLDE  60
VQRPEAMKSI IFQSYVRDRN PVHGCLGITQ QLQYMIWVAE EELKAVNSQL QLYRNGQNHP  120
NPHNMMIHEI GEKQEDLTSQ LDLGMGLPVN TNQGNNTIPF FSPVSETQQL QQPQHMSYCS  180
EVNNNHDYNP TPESCKEVLN NHNNTSLAWG QSQFPYNHHH NYGFMNQNEH CSETKNNNSV  240
MAIQSQLVNL QMASNQQEEE VDVHNYDEIH QFLEIIDESQ SFTETKEVYA SSSGESSKEP  300
IDEIGEKELR RAATCFSLTS VN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-2561177118LOB family transfactor Ramosa2.1
5ly0_B4e-2561177118LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_02389.1_g00007.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018437785.10.0PREDICTED: LOB domain-containing protein 27
SwissprotQ9STS61e-121LBD27_ARATH; LOB domain-containing protein 27
TrEMBLA0A078HJA30.0A0A078HJA3_BRANA; BnaA06g17030D protein
TrEMBLA0A3P5YTK10.0A0A3P5YTK1_BRACM; Uncharacterized protein
STRINGBra018102.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63032746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.11e-123LOB domain-containing protein 27
Publications ? help Back to Top
  1. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]