PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02295.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CPP
Protein Properties Length: 581aa    MW: 61845.2 Da    PI: 8.2074
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02295.1_g00005.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.81.2e-14121160141
                      TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                              ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ +
  Rsa1.0_02295.1_g00005.1 121 QKKKQCNCKHSRCLKLYCECFASGTYCDG-CNCVNCFNNVD 160
                              589**************************.********986 PP

2TCR50.73.5e-16206244139
                      TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                              k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN 
  Rsa1.0_02295.1_g00005.1 206 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCLDCKNF 244
                              589***********************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.0E-16121161IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.179122246IPR005172CRC domain
PfamPF036387.3E-11123158IPR005172CRC domain
SMARTSM011144.4E-19206247IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.0E-12209244IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 581 aa     Download sequence    Send to blast
MSEGGGGGGG GGGEFPPKKE DVTDESSFPG KTPARQLDFT GGNSLSKPTA VVATTNIVTP  60
SVPSPMASRL HPVGRPTLHV VTTNQPSQAQ ILNAPIRLPK PESPISRPRP PIVEGRDGTP  120
QKKKQCNCKH SRCLKLYCEC FASGTYCDGC NCVNCFNNVD NEPARRDAVE ATLERNPNAF  180
RPKIASSPHG VRDKREEIGE VVLLGKHNKG CHCKKSGCLK KYCECFQANI LCSENCKCLD  240
CKNFDGSEER QALFHGEHAN NMAYLQQAAN AAITGAVGSS GFAPSPAPKR RKGHDISFNQ  300
TTKDSSTHRL GQFPQANNGR TTGTSPATVS RPGGNSSAAP SKFVYRSLLA DIIQPQDVKA  360
LCSVLVAVAG EAAKTLTDER NETEASLASS AQDNSQGNKD VEMVAADKSG PEGSNSDGAD  420
ASKGKPLSPA TMALMCDEQD TIFMVAAAEP NGSVDPGGCR TNSQEQSEIY AEQERAVLTK  480
FRDCLSRLIS YAEIKESKCS YLARRHIQSP PTATATAAVK TENGIQQIPP VVNGASRTTA  540
QPTLSKPQPL QPTTTTNTST TQQHPPHKPP ALPEKKDPQN Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-311062558132Protein lin-54 homolog
5fd3_B2e-311062558132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_02295.1_g00005.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1186580.0AK118658.1 Arabidopsis thaliana At4g29000 mRNA for putative transcription factor, complete cds, clone: RAFL19-93-A20.
GenBankBT0059310.0BT005931.1 Arabidopsis thaliana At4g29000 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018470192.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A078HCN60.0A0A078HCN6_BRANA; BnaA01g07920D protein
STRINGBo1g016960.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein