PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02192.1_g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family G2-like
Protein Properties Length: 375aa    MW: 42554.1 Da    PI: 8.7084
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02192.1_g00010.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.7e-32204257255
                  G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Rsa1.0_02192.1_g00010.1 204 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 257
                              9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15201257IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-28202257IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-23204257IPR006447Myb domain, plants
PfamPF002492.4E-7205256IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNSK PSSTWQRRRP EQEDHEELDL GFWRRALDSR TSSLVSNSSS  60
KKNNNHPLED LSLSNNSIHH QQQHPHLLPN YNGSNIFTSS QFPTQQHLQD FLAHDLNTHL  120
RPIRGIPLYQ NPPPHNHYRP PPCFPFDPSS LIHSSSPAPT GINNNTFGTR RVNPNHHNHQ  180
HHHQTLNRAR FMPRFPAKRS MRAPRMRWTT TLHARFVHAV ELLGGHERAT PKSVLELMDV  240
KDLTLAHVKS HLQMYRTVKT TDKAAASSGQ SDVYENGSSG DNNSDGWMFD MNRKSRDSNE  300
LTNPLEKSNG RWTNSSGEAR LHGKQIDNVA EIMLPSENEL DGKCSSYERI SSEEMSSSNI  360
SGTSPFKPNL EFTLG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0292110.0BT029211.1 Arabidopsis thaliana At1g32240 mRNA, complete cds.
GenBankAB4934910.0AB493491.1 Arabidopsis thaliana At1g32240 mRNA for hypothetical protein, partial cds, clone: RAAt1g32240.
GenBankAY0486890.0AY048689.1 Arabidopsis thaliana GARP-like putative transcription factor KANADI2 (KAN2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013587706.10.0PREDICTED: probable transcription factor KAN2 isoform X1
SwissprotQ9C6160.0KAN2_ARATH; Probable transcription factor KAN2
TrEMBLM4E3A30.0M4E3A3_BRARP; Uncharacterized protein
STRINGBra023254.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53872850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-171G2-like family protein