PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01894.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WRKY
Protein Properties Length: 1546aa    MW: 173421 Da    PI: 8.2018
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01894.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY98.64.1e-3114721529158
                               ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
                     WRKY    1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58  
                               ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk ver +ed ++v++tYeg+Hnh
  Rsa1.0_01894.1_g00003.1 1472 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHNNCRVKKSVERLSEDCRMVITTYEGRHNH 1529
                               59******************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF142442.5E-165296IPR029472Gag-polypeptide of LTR copia-type
PfamPF037321.6E-18113221IPR005162Retrotransposon gag domain
PfamPF139762.0E-10513584IPR025724GAG-pre-integrase domain
PROSITE profilePS5099418.566595758IPR001584Integrase, catalytic core
SuperFamilySSF530986.83E-38595752IPR012337Ribonuclease H-like domain
Gene3DG3DSA:3.30.420.101.7E-24596750IPR012337Ribonuclease H-like domain
PfamPF006659.8E-17597709IPR001584Integrase, catalytic core
SuperFamilySSF566721.45E-359661170No hitNo description
PfamPF077274.7E-459671080IPR013103Reverse transcriptase, RNA-dependent DNA polymerase
PfamPF077271.6E-2610821191IPR013103Reverse transcriptase, RNA-dependent DNA polymerase
SuperFamilySSF566721.45E-3512011382No hitNo description
CDDcd092722.05E-6512761407No hitNo description
Gene3DG3DSA:2.20.25.801.3E-3214571529IPR003657WRKY domain
SuperFamilySSF1182903.53E-2714641529IPR003657WRKY domain
PROSITE profilePS5081129.47114671529IPR003657WRKY domain
SMARTSM007745.8E-3714721531IPR003657WRKY domain
PfamPF031066.9E-2414731529IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0015074Biological ProcessDNA integration
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1546 aa     Download sequence    Send to blast
MVVTRRSTRR LGRSTTASAR RSSIPEDSSP VDSDTDELSP NSIHSPYYLT SGDNPGLSIV  60
SEVLDGTNYD NWSIAMNIAL DAKNKLAFID GSVARPLESH VHFRIWSRCN SMVKSWLLNT  120
VSKQIYKSIL RFNDTSEIWK DLQTRFHITN LPRSYQLSQQ ILSLQQGSMD LATYYTTLKT  180
LWDELDGANC ITTCRNCDCC KAMNTKADHA KVIKFLAGLN ESYAVIRSQI IMKKNVPELS  240
EIYNLLDQDH NQRNIIPVHN ATTFQVSAPS APPAPKQGRP VCSHCGYNGH TVDTCYKIHG  300
YPVDFKHKGK QQSDRTQYKK PPAKPVVAQV ALDDKSSATG FGTLTKDQIE GVIAYFNSQL  360
SPPPAQVNCV STSGGTITAL PGMVFSSSTL GFIGMLRMTG NVLCTESWVV DSGATHHVAH  420
DRHLFEELSD SVNTSVTLPT GFGVKISGIG KVRLSDSMVL TNVLFIPDFC LNLLSVSQTT  480
KDLGYRIAFD HDCCMIQDLT KGLMIGKGDQ IANLYVLDVA DIAVPRPLQD QLASVSNVVL  540
DSALWHHRLG HPSMLKTDSI IDVLGLQHKN KGAYHCDICP LAKQKRLPFK SNNNMTDHPF  600
DLLHIDVWGP FSTPTIEGYR YFLTIVDDHT RLTWIYLLKA KSDVLSVFPA FLKLVETQYQ  660
AVVKAVRSDN APELRFEELY KQKGIVSFHS CPETPEQNSV VERKHQHILN VARALMFQSQ  720
VPLELWGECV LTAVFLINRL PSPLLKDKSP LELLTSKPVD YTGLRVFGCL TYCTTSPKQR  780
TKFQPRARSC IFLGYPAGYK GYKLMDLETN QIFISRNVIF HEDIFPYTKG KLSCFHDIFS  840
STAVSDNSTL ASEEINGISD STTPPPAVVP DASAAESSGS RSIPESTKRI SKLPAHLEDY  900
YCNVNELNKD IPYPLSAYLT YDNLSTEYKA YICSVALYPE PTSFTQAKRF EEWLHAMNEE  960
LIALEKNDTW TVCSLPPGKH AIGCKWVYKI KINADGTLER YKARLVAKGY TQQEGIDFAE  1020
TFSPVAKMTT VKTLVAVSAA KNWHLTQLDV SNAFLNGDLH EEIYMKLPPG YTPRKGKLCL  1080
RMLTTLLGLG FQKSNSDHTL FIRNIKGHYI AVLVYVDDII IASNVTEDVD QLKADLQKAF  1140
KIRDLGPLKY FLGLEIARSV QGISMCQRKY TLGLLEEAGL LACKPSLIPM DPGVKLIQDS  1200
PEPLLDDPCA YRRLVGKMMY LTITRPDITF AVNKLCQFTS APKPSHLQAA YKVLHYLKGT  1260
IGLGLFYSST SDLVLKGYTD ADWGSCADTR RSTSGYCMFL GNTLISWKSK KQQVASHSSA  1320
ESEYRAMEFG SREVIWLYNL LIELQAPQAR PVPYYCDSTA AIHIAHNSVF HERTKHIERD  1380
CHQIRDCIEA GYIKMLHVRT HDQIADVGGP LGSKVVNNDH ENIRGGINND VHSNSWWRSS  1440
SGSGEMKNKV KIRRKLREPR FCFQTKSDVD VLDDGYKWRK YGQKVVKNSL HPRSYYRCTH  1500
NNCRVKKSVE RLSEDCRMVI TTYEGRHNHI PSDDSTSPDH DCLSSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A9e-2414641529974Probable WRKY transcription factor 4
2lex_A9e-2414641529974Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
114501456KIRRKLR
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_01894.1_g00003.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4300340.0KF430034.1 Brassica rapa WRKY transcription factor 12 (WRKY12) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009128559.10.0PREDICTED: uncharacterized protein LOC103853393
TrEMBLA0A1J3H6S50.0A0A1J3H6S5_NOCCA; Retrovirus-related Pol polyprotein from transposon TNT 1-94
STRINGBra008452.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.11e-78WRKY family protein