PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01641.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WRKY
Protein Properties Length: 511aa    MW: 56696.5 Da    PI: 5.8632
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01641.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY90.71.2e-28265321359
                              -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                     WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                              Dgy+WrKYGqK vk +++prsYY C+++gC+vkk+ver+a+d k++++ Y+g+H h+
  Rsa1.0_01641.1_g00003.1 265 DGYRWRKYGQKIVKANPNPRSYYICSYSGCNVKKHVERAADDVKILVVSYNGRHVHP 321
                              9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.8E-28249323IPR003657WRKY domain
PROSITE profilePS5081129.792258323IPR003657WRKY domain
SuperFamilySSF1182901.11E-23258323IPR003657WRKY domain
SMARTSM007741.0E-29263322IPR003657WRKY domain
PfamPF031065.4E-22265321IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 511 aa     Download sequence    Send to blast
MSDYSDGNFM DMVSHWTSLP SPILGEIVAM PDQTDNGLNP ISNTFLPTNQ SEKKTSLVER  60
VSTRVGRNIP PLRIENLRPS ALFKNKKTVL GVNEISPGLS PSVMLQSPSQ LISPFSFPND  120
WPPETVENPG DDHAATMIFN NNVPYQPMHF DLPPQEGSYM MVPVTGNSAY IPSHESQVDP  180
IGAPLVASFE SELADDPDFS KLLSFPLDDE SESQEDDDIA GELEIKPSSP KRRKYEASDM  240
ITAGITSKDP SVIIRMETEE DQPCDGYRWR KYGQKIVKAN PNPRSYYICS YSGCNVKKHV  300
ERAADDVKIL VVSYNGRHVH PEPGPRSSSS SGPKNRPRSS VAARLGRPPF SSSSAARDKR  360
PLATQNMRPF AYPSASATQD MRPFPSSLNS GVDMTHLYKT GLSKMPSLPV NQTHGLMGQN  420
AEPWINQNHG LMGQNAEPWV NQNHGFMDQN AEPWVNQNHG FMGDNVEPCI NQNHGLMGQN  480
DKPKTDHVIP DGTEVYKWIM ERLLANFGVK H
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-21254324878Probable WRKY transcription factor 4
2lex_A5e-21254324878Probable WRKY transcription factor 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_01641.1_g00003.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018479053.10.0PREDICTED: probable WRKY transcription factor 10
TrEMBLA0A078IT850.0A0A078IT85_BRANA; BnaC06g07320D protein
STRINGBo6g034690.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2037656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G55600.11e-67WRKY DNA-binding protein 10