PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01440.1_g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family M-type_MADS
Protein Properties Length: 317aa    MW: 36578 Da    PI: 9.3664
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01440.1_g00008.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF45.78.6e-151252545
                             SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
                   SRF-TF  5 nksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                             n+  r  ++ kRr g+ KK +EL +LCd+++++i+fs++  
  Rsa1.0_01440.1_g00008.1 12 NENLRALSLKKRRSGLVKKVKELTILCDVKACLIMFSPKEA 52
                             88899********************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-18159IPR002100Transcription factor, MADS-box
CDDcd002661.10E-23183No hitNo description
PROSITE profilePS5006615.32150IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-8222IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-18392IPR002100Transcription factor, MADS-box
PfamPF003191.4E-131151IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-82237IPR002100Transcription factor, MADS-box
PRINTSPR004047.7E-83758IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MTKKIKLALM ANENLRALSL KKRRSGLVKK VKELTILCDV KACLIMFSPK EAVPMVWPSA  60
EAARNLLNDF NALPDFLKKK NETTLESYLK EKTWKVHENL RKTQKENMEG KIDQLMVQLN  120
CFRSRKVDDL DVKEIYSLIS FSKDGIMHLR KKVGSVQHCP LRDPPVYPFG EQVKEFRTTT  180
GGGQEHERAR KTFEEVNMAS IGASKEKQSY YLMDEWTFPS LKPPSPRTHQ QIMMNMASYI  240
SNLDPRCYQS YHPYQGSSSN GDYSLEMEPA FPPMLAFPDF VGPVSHPYPF DFMSHEERSN  300
INNNNNANNG FVQRHQQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_01440.1_g00008.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0116220.0AP011622.1 Brassica rapa subsp. pekinensis DNA, chromosome: Linkage group A5, BAC clone: KBrB038I07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018491092.10.0PREDICTED: floral homeotic protein PMADS 2-like
TrEMBLA0A0D3CL250.0A0A0D3CL25_BRAOL; Uncharacterized protein
TrEMBLA0A3P6F4160.0A0A3P6F416_BRAOL; Uncharacterized protein
STRINGBo5g135120.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47241446
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40210.13e-77AGAMOUS-like 48