PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01436.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NF-YA
Protein Properties Length: 281aa    MW: 30934.6 Da    PI: 10.3436
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01436.1_g00005.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.32.2e-32157213158
                CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                              +ep++VNaKQy++Il+RR++Rakle+++kl +ksrkpylheSRh hAl+R+RgsgGrF
  Rsa1.0_01436.1_g00005.1 157 NEPIFVNAKQYHAILRRRKHRAKLEAQNKL-IKSRKPYLHESRHLHALKRARGSGGRF 213
                              59****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.3E-36155216IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.46156216IPR001289Nuclear transcription factor Y subunit A
PfamPF020454.3E-27158213IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.4E-23159181IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860161181IPR018362CCAAT-binding factor, conserved site
PRINTSPR006164.4E-23190213IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0009785Biological Processblue light signaling pathway
GO:0010262Biological Processsomatic embryogenesis
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MQVFQNKVSS RSTWESSNTQ GSQSFSLTKN MMMMKHSSLQ LQNKDSSSTQ STGDSGGGEA  60
ASFGEPNRYG SSSIAVNTIL PGYNKSTNTS SMVSQEPVFP PSACGLPSWP LQCAETSHLN  120
GFLTPEYAAS QPTALTHLDM MGLVTSRVPL PHNIQENEPI FVNAKQYHAI LRRRKHRAKL  180
EAQNKLIKSR KPYLHESRHL HALKRARGSG GRFLNTKKKL QESSNSPLCF SQMANGEGEG  240
FSKSSITPSS SSDRNNMFQN TPFRFSGYPS THHVSALMSE T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-19158219364NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0814451e-137AY081445.1 Arabidopsis thaliana unknown protein (At1g54160) mRNA, complete cds.
GenBankAF3869571e-137AF386957.1 Arabidopsis thaliana Unknown protein (F15I1.26) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013592816.11e-169PREDICTED: nuclear transcription factor Y subunit A-5
RefseqXP_013592817.11e-169PREDICTED: nuclear transcription factor Y subunit A-5
RefseqXP_013643654.11e-169PREDICTED: nuclear transcription factor Y subunit A-5-like
RefseqXP_013643655.11e-169PREDICTED: nuclear transcription factor Y subunit A-5-like
SwissprotQ9SYH41e-124NFYA5_ARATH; Nuclear transcription factor Y subunit A-5
TrEMBLW6D5Z61e-168W6D5Z6_BRANA; Transcription factor subunit NF-YA5A
STRINGBra037968.1-P1e-151(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM116331733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.11e-115nuclear factor Y, subunit A5