PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01409.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bHLH
Protein Properties Length: 208aa    MW: 23475.7 Da    PI: 6.167
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01409.1_g00005.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH19.51.8e-0663117155
                              CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
                      HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                              +++  n+ Er RR r+  ++ +L +ll   s+ ++kK    +i  ++v YI +Lq
  Rsa1.0_01409.1_g00005.1  63 KKQERNAKERLRRMRLHASYLTLGTLLTDHSSSSKKKWCAPSIMDRVVTYIPKLQ 117
                              67889************************87888899***************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474597.07E-956126IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088810.25262116IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.106.4E-763121IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003530.003268122IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MSDHQILASS LLEDLLHIPA ETTVEEFREK DDTFRAQTES KGKEVVAVLH DEDARGSSGG  60
AAKKQERNAK ERLRRMRLHA SYLTLGTLLT DHSSSSKKKW CAPSIMDRVV TYIPKLQNEV  120
EELTLRKKKT CDEAVVQISM ETEKEDEFSN LLHVMEMQGS SILSASTSLV CRDQKVVCYN  180
FHVKMDGKPC EGDDYITVLK NNIISLLS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0169722e-31AC016972.7 Arabidopsis thaliana chromosome 1 BAC F23N20 genomic sequence, complete sequence.
GenBankAC0161622e-31AC016162.5 Arabidopsis thaliana chromosome 1 BAC F3I17 genomic sequence, complete sequence.
GenBankCP0026842e-31CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009105785.11e-129PREDICTED: uncharacterized protein LOC103831644
TrEMBLA0A078CCQ81e-123A0A078CCQ8_BRANA; BnaC06g32310D protein
STRINGBra016156.1-P1e-111(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM105582234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71200.13e-87bHLH family protein