PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01362.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bHLH
Protein Properties Length: 90aa    MW: 10126.3 Da    PI: 8.5328
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01362.1_g00006.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH25.81.9e-0817571454
                             HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                      HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                             d+i +   +L+ l+P++ + +s+K+s +++L++++ YI++L
  Rsa1.0_01362.1_g00006.1 17 DQISDLVTKLQHLIPELRRRRSGKVSASTVLQETCSYIRNL 57
                             68999999********88*********************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088811.096357IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.106.0E-9473IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474591.57E-91676IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000104.7E-61757IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 90 aa     Download sequence    Send to blast
MSSRRSRQSG SSRISDDQIS DLVTKLQHLI PELRRRRSGK VSASTVLQET CSYIRNLHRE  60
VDDLSDRLSE LLASTDDNSA EAAIIRSLLN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0046861e-103BT004686.1 Arabidopsis thaliana At1g26948 gene, complete cds.
GenBankAK1191101e-103AK119110.1 Arabidopsis thaliana mRNA for unknown protein, complete cds, clone: RAFL21-46-D20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006303467.11e-43hypothetical protein CARUB_v10010751mg
RefseqXP_013595899.19e-44PREDICTED: transcription factor PRE6
RefseqXP_013690768.19e-44PREDICTED: transcription factor PRE6-like
SwissprotQ8GW326e-45PRE6_ARATH; Transcription factor PRE6
TrEMBLA0A078GTH89e-44A0A078GTH8_BRANA; BnaC07g12550D protein
TrEMBLA0A0D3D6W89e-44A0A0D3D6W8_BRAOL; Uncharacterized protein
TrEMBLR0IDT71e-43R0IDT7_9BRAS; Uncharacterized protein
STRINGBra024672.1-P4e-43(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25928225
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.11e-41bHLH family protein