PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01190.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NF-YA
Protein Properties Length: 193aa    MW: 21764.5 Da    PI: 9.3465
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01190.1_g00005.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA107.21.3e-33110166158
                CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                              +ep++VNaKQy++Il+RRq+Rakle+++k+  ksrkpylheSRh hA+rRpRg+gGrF
  Rsa1.0_01190.1_g00005.1 110 EEPVFVNAKQYHGILRRRQSRAKLESQNKV-VKSRKPYLHESRHLHAIRRPRGCGGRF 166
                              69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005215.2E-38108169IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.642109169IPR001289Nuclear transcription factor Y subunit A
PfamPF020454.2E-28111166IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.2E-24112134IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860114134IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.2E-24143166IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MASSIHELSG STLSFSLFIH NIEIHDKQGH KDSQFQIQPP IPPGRNSAVY SEQLPHSMAP  60
GHYPYPDHYY RSICAPNPQA FPPRPYETGV HAHLMGVQQQ CVPLPSDAVE EPVFVNAKQY  120
HGILRRRQSR AKLESQNKVV KSRKPYLHES RHLHAIRRPR GCGGRFLNAK KEEEHHEGSH  180
VEEKSMAASA GTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-21109176168NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0055612e-83BT005561.1 Arabidopsis thaliana clone U50095 putative transcription factor (At1g30500) mRNA, complete cds.
GenBankBT0042742e-83BT004274.1 Arabidopsis thaliana clone RAFL15-46-O22 (R50095) putative transcription factor (At1g30500) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009115137.11e-121PREDICTED: nuclear transcription factor Y subunit A-7
RefseqXP_009115138.11e-121PREDICTED: nuclear transcription factor Y subunit A-7
SwissprotQ84JP11e-85NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
TrEMBLM4EUB31e-121M4EUB3_BRARP; Uncharacterized protein
STRINGBra032395.1-P1e-120(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41682756
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.25e-77nuclear factor Y, subunit A7