PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01181.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family G2-like
Protein Properties Length: 400aa    MW: 45405.4 Da    PI: 9.0579
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01181.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.94.1e-32227280255
                  G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Rsa1.0_01181.1_g00002.1 227 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 280
                              9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.15E-15224280IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-28225280IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-23227280IPR006447Myb domain, plants
PfamPF002492.7E-7228279IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNSK PSSTWQKRRS TTDQGEHGEL DLGFWRRALD SRTSLVCNPS  60
SRTTSNNHHP LGDLSLSNNS HQHQHQHQHQ HQHQKQQHQH PHLLPNCNGS NILTSFQFQT  120
QQQQQGFLAH DLNTHLRPIR GIPLYQNPQP HHHHRPPPPY FPFDPSSLIP SSLLTPTAIN  180
NSFGTSSVSN SGLITNPNYH NHQHHRQTLN RDRFMPRFPA KRSMRAPRMR WTTTLHARFV  240
HAVELLGGHE RATPKSVLEL MDVKDLTLAH VKSHLQMYRT VKTTDKAASS GQSDVYENGS  300
SGDNNSDDWM FDMNRKSRDS DELMNPLEKS NGLWTNSSGE ARLHGKVIDN VAELMLPSEK  360
EIDGKFSSYE RIPSEEMSLS SISGTSPVKP NLEFTLGRSH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0292110.0BT029211.1 Arabidopsis thaliana At1g32240 mRNA, complete cds.
GenBankAY0486890.0AY048689.1 Arabidopsis thaliana GARP-like putative transcription factor KANADI2 (KAN2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013613867.10.0PREDICTED: probable transcription factor KAN2
SwissprotQ9C6160.0KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A0D2ZR210.0A0A0D2ZR21_BRAOL; Uncharacterized protein
STRINGBra033844.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53872850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-179G2-like family protein