PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01148.1_g00009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family SBP
Protein Properties Length: 179aa    MW: 20668.2 Da    PI: 10.2198
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01148.1_g00009.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.94.6e-4163138277
                              -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                      SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                              C v++C+a+l+eak+y+rrh+vCevh+ka++++v+g++qrfCqqCsrfhel efDe+krsCrrrLa+hnerrrk +
  Rsa1.0_01148.1_g00009.1  63 CLVDRCTANLTEAKQYYRRHRVCEVHAKASSATVAGVKQRFCQQCSRFHELAEFDETKRSCRRRLAGHNERRRKIS 138
                              *************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114130.75260137IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.101.9E-3161124IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.09E-3762141IPR004333Transcription factor, SBP-box
PfamPF031101.8E-3163136IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MEGQRSRQWG YLKDKAIATN LAEEEMENGM DGEENDGGDE DKRKRVMERA RGPSTDRVPL  60
RLCLVDRCTA NLTEAKQYYR RHRVCEVHAK ASSATVAGVK QRFCQQCSRF HELAEFDETK  120
RSCRRRLAGH NERRRKISGD SFGEGSGRSG ISLTQTQERR RIDMKLPMTN SSFKRPQIR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-3960136884squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00359DAPTransfer from AT3G15270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0037140.0BT003714.1 Arabidopsis thaliana At3g15270 mRNA, complete cds.
GenBankAK1186110.0AK118611.1 Arabidopsis thaliana At3g15270 mRNA for squamosa promoter binding protein-like 5, putative, complete cds, clone: RAFL19-86-N19.
GenBankAJ2429600.0AJ242960.1 Arabidopsis thaliana mRNA for Squamosa promoter binding protein-like 5, (SPL5 gene).
GenBankAJ0116100.0AJ011610.1 Arabidopsis thaliana (ecotype Landsberg erecta) mRNA for squamosa promoter binding protein-like 5.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013638829.11e-122PREDICTED: squamosa promoter-binding-like protein 5
SwissprotQ9S7581e-100SPL5_ARATH; Squamosa promoter-binding-like protein 5
TrEMBLA0A078E9121e-122A0A078E912_BRANA; BnaC05g38350D protein
TrEMBLA0A0D3CJZ01e-122A0A0D3CJZ0_BRAOL; Uncharacterized protein
STRINGBra027265.1-P1e-120(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.11e-96squamosa promoter binding protein-like 5