PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00977.1_g00014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NF-YA
Protein Properties Length: 255aa    MW: 28574.4 Da    PI: 9.5405
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00977.1_g00014.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA106.42.4e-33117173158
                CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                              +ep+YVNaKQy++I++RRq+Rak+e ekkl +ksrkpylheSRh+hA+rRpRg+gGrF
  Rsa1.0_00977.1_g00014.1 117 QEPVYVNAKQYEAIMRRRQARAKAELEKKL-IKSRKPYLHESRHQHAMRRPRGTGGRF 173
                              69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005218.1E-37115176IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.085116176IPR001289Nuclear transcription factor Y subunit A
PfamPF020457.3E-29118173IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.0E-24119141IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860121141IPR018362CCAAT-binding factor, conserved site
PRINTSPR006164.0E-24150173IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MHSKSDVSEV HHHHTSSNGS KSPSNRDESG NKEESLVTTS PQQSGGDNSE KSQEPVHPGT  60
TPPPPHPQLV SHAVGWTSSN LYQDPYYAGM MGAYPLAYVP YGGMPHSRMQ LPPEMAQEPV  120
YVNAKQYEAI MRRRQARAKA ELEKKLIKSR KPYLHESRHQ HAMRRPRGTG GRFAKKSNTD  180
DSRKKAGEKN SACPTQSPTS SNSDQPEAWS DEYRTHQSEE MQSSGYKRRE EADCLGQQWN  240
NISSNHPSQA RLAIK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-19117180265NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBNU338850.0U33885.1 Brassica napus clone bncbf-b2 CCAAT-binding factor B subunit homolog mRNA, complete cds.
GenBankBNU338840.0U33884.1 Brassica napus clone bncbf-b1 CCAAT-binding factor B subunit homolog mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013716881.11e-143PREDICTED: nuclear transcription factor Y subunit A-9-like isoform X4
RefseqXP_013716883.11e-143PREDICTED: nuclear transcription factor Y subunit A-9-like isoform X6
RefseqXP_013716884.11e-143PREDICTED: nuclear transcription factor Y subunit A-9-like isoform X6
RefseqXP_013720562.11e-143PREDICTED: nuclear transcription factor Y subunit A-9-like isoform X4
RefseqXP_013720564.11e-143PREDICTED: nuclear transcription factor Y subunit A-9-like isoform X6
RefseqXP_013720565.11e-143PREDICTED: nuclear transcription factor Y subunit A-9-like isoform X6
SwissprotQ945M91e-132NFYA9_ARATH; Nuclear transcription factor Y subunit A-9
TrEMBLA0A078D4K11e-143A0A078D4K1_BRANA; BnaA03g35980D protein
STRINGBra001806.1-P1e-136(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM132681829
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20910.11e-124nuclear factor Y, subunit A9