PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00838.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WRKY
Protein Properties Length: 529aa    MW: 57706.2 Da    PI: 6.9077
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00838.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY107.37.8e-34350408159
                              ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                     WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                              ldDgy+WrKYGqK+v+g+++prsYY+Ct +gCpv+k+ver+++dpk+v++tYeg+Hnh+
  Rsa1.0_00838.1_g00001.1 350 LDDGYRWRKYGQKVVRGNPNPRSYYKCTAPGCPVRKHVERASHDPKAVITTYEGKHNHD 408
                              59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.0E-37335410IPR003657WRKY domain
SuperFamilySSF1182901.57E-29342410IPR003657WRKY domain
PROSITE profilePS5081138.629345410IPR003657WRKY domain
SMARTSM007743.1E-39350409IPR003657WRKY domain
PfamPF031064.2E-26351408IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009961Biological Processresponse to 1-aminocyclopropane-1-carboxylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 529 aa     Download sequence    Send to blast
MNPQVNNDRK DFPVDPTARH DSAGGGGGGN GGGGARYKLM SPAKLPISRS TDNITIPPGL  60
SPTSFLESPV FISNIKPEPS PTTGSLFKPR PVHVSSISYT GRPFHQDSTF PEQKSCEFEF  120
RPPASTMFRG GLCLNVFIGI KVYAELDKHK IEPAVQFQGQ GYGSSSHSPS SFSEAAVTSS  180
ELSRPTPPSQ TTGTSSDVPA GSEQDESQND PRGSTPSVLA DDGYNWRKSY DGQITDIIYK  240
GTHDHPKPQP GRRNSGGFGV PAAQEERVEK VSGVYNLSQA IEQTGNPEVP PTIEDGGDAA  300
VSYKNKDDQD EDDPYTKRRR LDGTMEITPL VKAIREPRVV VQTLSEVDIL DDGYRWRKYG  360
QKVVRGNPNP RSYYKCTAPG CPVRKHVERA SHDPKAVITT YEGKHNHDVP TTKSSSNHDN  420
QPRFRPRETD SISLNLGVGI SSDGPDHASN ERQHQNQQQQ LINQTHPNGV GFRFVHAAPV  480
SSYYASLSSG VNQYAPSETQ NETQNGDISS LNHSSYPYPH NIGRIQSGP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-38341410877Probable WRKY transcription factor 4
2lex_A8e-38341410877Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1316320KRRRL
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00455DAPTransfer from AT4G26640Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_00838.1_g00001.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM5931330.0KM593133.1 Brassica oleracea var. capitata WRKY transcription factor (WRKY9) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018446156.10.0PREDICTED: probable WRKY transcription factor 20
SwissprotQ93WV00.0WRK20_ARATH; Probable WRKY transcription factor 20
TrEMBLA0A398APL70.0A0A398APL7_BRACM; Uncharacterized protein
STRINGBra026414.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31332867
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26640.20.0WRKY family protein