PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00832.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NF-YC
Protein Properties Length: 245aa    MW: 27813.2 Da    PI: 9.5112
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00832.1_g00007.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC44.14.6e-141432271599
                    NF-YC  15 dfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 
                              + k  ++P++ri++i+++d+   +i  +a  l+ ka elfi  ++  ++  + + k++ ++   ++++v++ + ++fl+d vp++
  Rsa1.0_00832.1_g00007.1 143 EAKMIRFPMTRIRRIMRSDNSAPQIMQDAVFLVNKATELFIERFSEEAYGSSVKDKKKFIHYKHLSSVVSSKERYEFLTDCVPEK 227
                              567789****************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008082.5E-20148211IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.105.9E-23149226IPR009072Histone-fold
SuperFamilySSF471132.01E-17158226IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MVSSKKPKSD VVVVDKGNGL NNTRGSGSKT KNKKKTPNKA DLKDYVTPRW SGGGGGDFRR  60
NFGGRVRLRP SSDCGDSGGY GFVSTRGTRW WLCMHQIRND YVARKETEEE EVRDEISESS  120
SSSEEARRDE ETKERSNGVV SEEAKMIRFP MTRIRRIMRS DNSAPQIMQD AVFLVNKATE  180
LFIERFSEEA YGSSVKDKKK FIHYKHLSSV VSSKERYEFL TDCVPEKLKA EAALEEWERS  240
MADVG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7971473e-36KC797147.1 Brassica napus transcription factor subunit NF-YC10B (NF-YC10B) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009148047.14e-68PREDICTED: chromatin accessibility complex protein 1
RefseqXP_013646475.14e-68PREDICTED: chromatin accessibility complex protein 1-like
TrEMBLM4DQ754e-68M4DQ75_BRARP; Uncharacterized protein
STRINGBra018668.1-P1e-67(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM111902231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.13e-52nuclear factor Y, subunit C10