PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00740.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family GeBP
Protein Properties Length: 409aa    MW: 44751.3 Da    PI: 5.3737
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00740.1_g00005.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573117.38.9e-37150245297
                   DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqk 87 
                              +fqr+wseeDei+ LqGl d++++tg+sp+dd++afy  vkksisf+vsk+ql++K+  LK K++++  k k+g+e++fsk+hd+k
  Rsa1.0_00740.1_g00005.1 150 YFQRVWSEEDEIAALQGLNDYRDETGASPYDDTNAFYLSVKKSISFDVSKTQLLKKLWGLKTKYENNLGKEKNGEEVAFSKPHDRK 235
                              79************************************************************************************ PP

                   DUF573  88 ifelskkiWg 97 
                              +f+lsk +Wg
  Rsa1.0_00740.1_g00005.1 236 AFDLSKLFWG 245
                              *********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045046.1E-32151245IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MSKKRFNPLE DPPNASSSDE DNDEMEAVNS SSEEETDDDE SSLKKPESAA PEKKHQPSDS  60
GSGSGSGSDE ETDSDSQTER KNSSAVKSIT GTKDPAVAVA KKNHDSDKKV KPLTKCSTKK  120
RSLSDTDGAA AEAKKAKTTV TGEESAKKSY FQRVWSEEDE IAALQGLNDY RDETGASPYD  180
DTNAFYLSVK KSISFDVSKT QLLKKLWGLK TKYENNLGKE KNGEEVAFSK PHDRKAFDLS  240
KLFWGGDGVA LDSAVKSNGK KSKKSSNSKK VEEESEKVAL DSANGKSKKS SSKKVDPEKK  300
ELVSSSSPNG KSCEEEVVTT NKREASPLGI VAEVDAAFEK SGLVKAVARF GVDDITAQQG  360
WSRLALEDKK RFEEEWKVLQ LRELELYSQK SGFIHEVVTK MAESFQPNP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013638352.11e-166PREDICTED: mediator-associated protein 1
TrEMBLA0A0D3C9B91e-166A0A0D3C9B9_BRAOL; Uncharacterized protein
STRINGBra019847.1-P1e-157(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G11510.11e-53DNA-binding storekeeper protein-related transcriptional regulator