PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00722.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NF-YA
Protein Properties Length: 243aa    MW: 27437.1 Da    PI: 10.4547
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00722.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA91.88.4e-2979135158
                CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                              +ep++VNaKQy++Il+RRq+Ra+le++++   ks+kpy+heS h hA++R Rg+gGrF
  Rsa1.0_00722.1_g00001.1  79 EEPVFVNAKQYHGILRRRQSRAELEARNRD-MKSKKPYMHESWHLHAINRLRGCGGRF 135
                              69************************9998.9*************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.6E-3077138IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115232.7878138IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.0E-2480135IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.1E-2081103IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.1E-20112135IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MNSVKSTGKA PVTTRKAHVT TIKASRSRRH AHGLYPYPDP YYRSIFAQQT YLLHPDPGVQ  60
MQLMGMHQQV VPLQYDAVEE PVFVNAKQYH GILRRRQSRA ELEARNRDMK SKKPYMHESW  120
HLHAINRLRG CGGRFLIAKK KNGGRKEEED TTSDENTSEA SSSLRSEKSA IAPNVNGVSS  180
AAVGLHSKES RGTGPFDKSH SLFEPVMEYN IGVLVRGKKV RDENKSTTLY HRVVINVEQI  240
KAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A4e-1878142165NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1147111e-117AY114711.1 Arabidopsis thaliana putative CCAAT-binding transcription factor subunit (At2g34720) mRNA, complete cds.
GenBankAY0724141e-117AY072414.1 Arabidopsis thaliana putative CCAAT-binding transcription factor subunit (At2g34720) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013692493.11e-89PREDICTED: nuclear transcription factor Y subunit A-4
RefseqXP_013692494.11e-89PREDICTED: nuclear transcription factor Y subunit A-4
RefseqXP_013692495.11e-89PREDICTED: nuclear transcription factor Y subunit A-4
RefseqXP_013692496.11e-89PREDICTED: nuclear transcription factor Y subunit A-4
SwissprotQ8VY642e-83NFYA4_ARATH; Nuclear transcription factor Y subunit A-4
TrEMBLA0A078D5731e-89A0A078D573_BRANA; BnaC04g10470D protein
STRINGBra005397.1-P2e-84(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41682756
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34720.13e-68nuclear factor Y, subunit A4