PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00703.1_g00016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NF-YA
Protein Properties Length: 118aa    MW: 13499.2 Da    PI: 10.5777
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00703.1_g00016.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA89.35.4e-281975158
                CBFB_NFYA  1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
                             +ep+++NaKQy++Il+RRq+Rakl+++++   +s+kpy+heSRh h ++R Rg+gGrF
  Rsa1.0_00703.1_g00016.1 19 EEPFFINAKQYHGILRRRQSRAKLAARNRA-MQSKKPYMHESRHLHEINRLRGCGGRF 75
                             69****************************.9*************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.4E-291778IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115232.491878IPR001289Nuclear transcription factor Y subunit A
PfamPF020454.6E-232075IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.1E-202143IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.1E-205275IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 118 aa     Download sequence    Send to blast
MQLMGIHQQV VPLQCDAVEE PFFINAKQYH GILRRRQSRA KLAARNRAMQ SKKPYMHESR  60
HLHEINRLRG CGGRFFNAKK KNGGRKEEEE ETTSDENTSE ASSSLRSEKS AMAPNGRS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A6e-201882165NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013692493.12e-68PREDICTED: nuclear transcription factor Y subunit A-4
RefseqXP_013692494.12e-68PREDICTED: nuclear transcription factor Y subunit A-4
RefseqXP_013692495.12e-68PREDICTED: nuclear transcription factor Y subunit A-4
RefseqXP_013692496.12e-68PREDICTED: nuclear transcription factor Y subunit A-4
SwissprotQ8VY643e-64NFYA4_ARATH; Nuclear transcription factor Y subunit A-4
TrEMBLA0A078D5732e-68A0A078D573_BRANA; BnaC04g10470D protein
STRINGBra005397.1-P2e-66(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41682756
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34720.13e-47nuclear factor Y, subunit A4