PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00553.1_g00014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NF-YA
Protein Properties Length: 268aa    MW: 29540.5 Da    PI: 9.6865
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00553.1_g00014.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA92.64.9e-29141198158
                CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                              d++++VN+KQy++I++RRq+Rak++ ++k+++  ++py+h+SRh hA+rRpRgsgGrF
  Rsa1.0_00553.1_g00014.1 141 DDTIFVNSKQYHGIIRRRQSRAKAALKNKISSCRKQPYMHHSRHLHAMRRPRGSGGRF 198
                              578***************************9999***********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005215.1E-32139201IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115234.495140201IPR001289Nuclear transcription factor Y subunit A
PfamPF020454.8E-24143198IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.1E-20143165IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.1E-20175198IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MQTEYRKERE EHFSPPPQIS CLWNIAFGSP ALTTESLSSD SLAGVKVVTP ETKSEQGVDK  60
QSSATLLTFS PGGGKSSIDV SKPHAAFTVQ PACFEFGFAQ PTIYTKHPDH VEPYYGVVSG  120
YGSQISPGRV MLPLKMETEE DDTIFVNSKQ YHGIIRRRQS RAKAALKNKI SSCRKQPYMH  180
HSRHLHAMRR PRGSGGRFLN AKKADAALQS KPSTSQCSEV FHPKNGTIVS DSDVTSMDHF  240
LSSSVHSNVS NMVMPSKWIA AAMDILKI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-15141214274NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013680966.11e-150PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X1
SwissprotQ8LFU01e-121NFYAA_ARATH; Nuclear transcription factor Y subunit A-10
TrEMBLA0A0D3EHB51e-149A0A0D3EHB5_BRAOL; Uncharacterized protein
STRINGBra009200.1-P1e-141(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30082767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.21e-114nuclear factor Y, subunit A10