PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00509.1_g00014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NF-YA
Protein Properties Length: 256aa    MW: 28131.9 Da    PI: 6.909
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00509.1_g00014.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA91.51e-28171226158
                CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                              +ep+YVNaKQyq+Il+RR++Rak+e e+k   ++ kpylheSRh+hA+rR+R+sgGrF
  Rsa1.0_00509.1_g00014.1 171 QEPVYVNAKQYQGILRRRKARAKAELERKA--TNGKPYLHESRHNHAVRRARASGGRF 226
                              69**************************99..899**********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.4E-28169229IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115231.774170229IPR001289Nuclear transcription factor Y subunit A
PfamPF020455.8E-25172226IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.9E-21173195IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860175195IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.9E-21203226IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MESNSGRGNE AEVNHNDAGQ QHQPMMYAEP WWKSNSFGVD RPSLVPSKSS SLEECPDGSE  60
SNDVHSAASE DDGACKDSQA PTSSPSVDNH GTEGNDPAQL AAPVGNMHCQ GQQLVQPPEL  120
VGHYIACVPN PYQDPYYGGM VGSYGHQQLQ GFHPYPGMPG ERTALPLDVT QEPVYVNAKQ  180
YQGILRRRKA RAKAELERKA TNGKPYLHES RHNHAVRRAR ASGGRFAKKT EAEVAAEREK  240
EKGFVQQPTR QALNRF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_A1e-14170231164HAPB protein
4g91_A1e-14170231164HAPB protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006399770.11e-120hypothetical protein EUTSA_v10014364mg
SwissprotQ9LXV51e-116NFYA1_ARATH; Nuclear transcription factor Y subunit A-1
TrEMBLV4LN101e-120V4LN10_EUTSA; Uncharacterized protein
STRINGAT5G12840.11e-113(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59462646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.32e-98nuclear factor Y, subunit A1