PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00504.1_g00015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bHLH
Protein Properties Length: 94aa    MW: 10747 Da    PI: 8.5092
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00504.1_g00015.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH24.55e-0820601454
                             HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                      HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                             d+i +   +L+ l+P++ + +s K+s + +L+++++YI++L
  Rsa1.0_00504.1_g00015.1 20 DQITDLVTKLQHLIPELRRRRSDKVSASKVLQETCNYIRNL 60
                             68899999********889********************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088810.099660IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.4E-52060IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.101.2E-82074IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474599.16E-92077IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 94 aa     Download sequence    Send to blast
MSSRRSSRSR QSGSSRISDD QITDLVTKLQ HLIPELRRRR SDKVSASKVL QETCNYIRNL  60
HREVDDLSDR LSELLASTDD DSAEAAIIRS LLNY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0046861e-120BT004686.1 Arabidopsis thaliana At1g26948 gene, complete cds.
GenBankAK1191101e-120AK119110.1 Arabidopsis thaliana mRNA for unknown protein, complete cds, clone: RAFL21-46-D20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009110054.19e-59PREDICTED: transcription factor PRE6
SwissprotQ8GW323e-47PRE6_ARATH; Transcription factor PRE6
TrEMBLA0A078IAZ41e-58A0A078IAZ4_BRANA; BnaA08g20020D protein
TrEMBLM4DIH21e-58M4DIH2_BRARP; Uncharacterized protein
STRINGBra016299.1-P3e-58(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25928225
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26945.13e-48bHLH family protein