PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00479.1_g00013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 661aa    MW: 73000 Da    PI: 7.1702
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00479.1_g00013.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.71.1e-093884251954
                              HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                 Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                              Fe+  ++yp+ +++  LAk++gLt +qV++WF N R +
  Rsa1.0_00479.1_g00013.1 388 FENflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 425
                              776669******************************88 PP

2BELL115.13.7e-37251322172
                     BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                              erqe+q+kkakL s+l+eV++rY+qy++q+q+vi sFe +ag+gsak+YtslAlk+iSr+Fr+Lk+aia+qi
  Rsa1.0_00479.1_g00013.1 251 ERQEIQMKKAKLSSMLHEVEQRYRQYHQQMQMVILSFEHAAGIGSAKSYTSLALKTISRQFRSLKEAIAGQI 322
                              79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.4E-71171320IPR006563POX domain
PfamPF075263.5E-44177319IPR006563POX domain
PROSITE profilePS5007112.26366429IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.9E-28368442IPR009057Homeodomain-like
CDDcd000867.44E-12369429No hitNo description
SMARTSM003891.0E-9369433IPR001356Homeobox domain
SuperFamilySSF466891.37E-16370436IPR009057Homeodomain-like
PfamPF059208.9E-18386425IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 661 aa     Download sequence    Send to blast
MAAYFHGNPP EISAGSDGGL QTLILMNPTT YVQYTQQDDD SNNNTNNNNS SFVFLDPHAP  60
PQNTSQQFVG VPLSGHKAAS ITSADNISVL QGYPQRVQYS HYSSHQVDPS HHQAACETPR  120
AQQGLFLTLS SQQQQHQQRQ NQHQTLHHVG FGSGPGEDIR VGSGSVGSGV TNGIVNLVSS  180
KYLKAAQELL DEVVKADSND INTKSQLFSS KKGTSGTDDR VVRESSTGAG EGSGGGGEAS  240
EKLTVEIGTA ERQEIQMKKA KLSSMLHEVE QRYRQYHQQM QMVILSFEHA AGIGSAKSYT  300
SLALKTISRQ FRSLKEAIAG QIKTANKSLG EEDSVSGVGR LKFVDHHLRQ QRAIQQHGMI  360
QHHPSNNAWR PQRGLPERAV SVLRAWLFEN FLHPYPKDSD KHMLAKQTGL TRSQVSNWFI  420
NARVRLWKPM VEEMYMEEMK EQGKNIGSME KEPNFDKNNE DSASKSTSNQ EKSPMRGGGA  480
DSYHLKPNHS GDLEGVSGMQ GSPKRLRTNE ETMMQPSNVD FTSNEKLTMK ILEERQGIRS  540
DGGYPFMGSF GQYQMDEMSR FDVAVSDQEL LAQRYSGNNN GVSLTLGLPH CDSLSSTHHQ  600
GFMQTHHGIP MERRVKIGET EEYGAATISA ATVHSSAAAY SGMNMQNQKR YVAQLLPDFV  660
A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-15375433563Homeobox protein Meis2
3k2a_B2e-15375433563Homeobox protein Meis2
4xrs_A2e-15375432158Homeobox protein Meis1
4xrs_B2e-15375432158Homeobox protein Meis1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_00479.1_g00013.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018440077.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_018440078.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A397Z7X40.0A0A397Z7X4_BRACM; Uncharacterized protein
STRINGBo4g036190.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50082650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.30.0BEL1-like homeodomain 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]