PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00442.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 204aa    MW: 23275.9 Da    PI: 10.334
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00442.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260110.41.3e-3420111192
                   DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqq 86 
                              aCa+Ck++r+kC+++C+l+pyfpa+++k+f++vhk+FG+snv+k+++ ++ee+r+++ +sl++eA +r++dPv G++g +++l+++
  Rsa1.0_00442.1_g00004.1  20 ACASCKHQRKKCNNECILSPYFPARKNKEFQAVHKVFGVSNVQKMVRIVREEDRTKLSESLTWEALWRQKDPVLGSYGEYRRLSEE 105
                              7************************************************************************************* PP

                   DUF260  87 leqlka 92 
                              l+  k+
  Rsa1.0_00442.1_g00004.1 106 LKLYKS 111
                              998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.51819119IPR004883Lateral organ boundaries, LOB
PfamPF031952.2E-3220111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MMQRNSNNSN ISSNSPPHQA CASCKHQRKK CNNECILSPY FPARKNKEFQ AVHKVFGVSN  60
VQKMVRIVRE EDRTKLSESL TWEALWRQKD PVLGSYGEYR RLSEELKLYK SVVHNQPLVT  120
WNSSNNQQRV FNNSNNNKNG LAVNSSDSGG FSVVNNNGVG VNREIINGGY TSRNLQGGWG  180
NLKQDQRQQY YAVINGFKQH HPPH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-172110612104LOB family transfactor Ramosa2.1
5ly0_B2e-172110612104LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_00442.1_g00004.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018490366.11e-151PREDICTED: LOB domain-containing protein 2-like
SwissprotQ9LNB91e-106LBD2_ARATH; LOB domain-containing protein 2
TrEMBLV4MVQ11e-112V4MVQ1_EUTSA; Uncharacterized protein
STRINGXP_006417938.11e-113(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM105392635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.11e-87LOB domain-containing protein 2