PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00420.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family M-type_MADS
Protein Properties Length: 300aa    MW: 34692.9 Da    PI: 6.5117
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00420.1_g00007.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF52.94.7e-171150342
                             --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
                   SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                             i n+s r+ tf kR++g +KK +ELSvLC+++++ +i+s+
  Rsa1.0_00420.1_g00007.1 11 ITNDSMRKSTFNKRKKGFFKKIYELSVLCGIQACAVIYSP 50
                             89************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.2E-23160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.437149IPR002100Transcription factor, MADS-box
CDDcd002666.00E-33285No hitNo description
SuperFamilySSF554551.96E-24295IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-9323IPR002100Transcription factor, MADS-box
PfamPF003191.3E-161150IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-92338IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-93859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MTRKKLNISY ITNDSMRKST FNKRKKGFFK KIYELSVLCG IQACAVIYSP FSSTPEVWPS  60
NSEVKKVVEK FEQIPDTEQE KKMVNHEGFL RQSITKTREN ITKKIMDNTD MAMNETMFQF  120
LRARGDMFQL SDKHRDDLCR HIDQYLKELY HHRKILNQSH LEHGESSSAA NAMTQPAAIA  180
EEGSSSLPNP DAFNSAKLVD TLWAPTSIIS SSQKLELIDT FENNYPPAAS DQQAYHQMMN  240
PVNLDLNPNQ YQQNFEGCPN SQDGIYNQNH QQEEWLVSQM MNNPNQVRFP MMDDNNHQQP
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_00420.1_g00007.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018490299.11e-179PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLM4FE831e-169M4FE83_BRARP; Uncharacterized protein
STRINGBra039404.1-P1e-170(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.19e-93M-type_MADS family protein