PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00402.1_g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family GeBP
Protein Properties Length: 364aa    MW: 40582 Da    PI: 4.9875
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00402.1_g00020.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573120.58.4e-3893186298
                   DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqk 87 
                              +fqrlwseeDei++LqG+idfka+tgksp++d+d+fye  +ksisf++sk q+v+Kir+LK+K+ +kv k  +g e s++k+hd +
  Rsa1.0_00402.1_g00020.1  93 TFQRLWSEEDEISVLQGMIDFKADTGKSPYEDMDRFYELTSKSISFEASKIQFVDKIRSLKRKYMGKVMK--QGVE-SLTKSHDID 175
                              79******************************************************************99..6666.9******** PP

                   DUF573  88 ifelskkiWgs 98 
                              +++l+k iWgs
  Rsa1.0_00402.1_g00020.1 176 CLKLAKYIWGS 186
                              *********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.3E-2894185IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MTRKKLNPLE DPPTASSSDE DELEPLPGDD EEEQISDDSS SDDLMSPVNI PSAKKSKSEK  60
PIAVAVKKRP MEMTSSVSAK RAKTAEEAKK PTTFQRLWSE EDEISVLQGM IDFKADTGKS  120
PYEDMDRFYE LTSKSISFEA SKIQFVDKIR SLKRKYMGKV MKQGVESLTK SHDIDCLKLA  180
KYIWGSHGMA LSSNVKKKVV QEEEEVVTPE SNGTPKKSKK KPLSVEGNGD KVEVGREVLI  240
NGDKGEEDRE VLAGGEKGRE DREVLANGDK VEEDKEVLMN AGGASKSLGV MRASDWFEHS  300
FLVGSIAGLG VSEQFVKEKW SMVTVETKKR MEEKWKLLQA KEMELVLQKT DFMREIGSVI  360
AESS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1214221PKKSKKKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013723127.10.0PREDICTED: mediator-associated protein 1-like
TrEMBLA0A0D3BYZ30.0A0A0D3BYZ3_BRAOL; Uncharacterized protein
STRINGBra032717.1-P1e-178(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.13e-65DNA-binding storekeeper protein-related transcriptional regulator