PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00392.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CPP
Protein Properties Length: 496aa    MW: 53812.5 Da    PI: 7.9008
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00392.1_g00005.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR44.82.4e-1496134241
                      TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                              +kk+CnCk s+Clk+YCeCfa+g++C+  C+C +C+N+ +
  Rsa1.0_00392.1_g00005.1  96 KKKHCNCKLSRCLKLYCECFASGSYCDG-CNCANCFNNVD 134
                              799*************************.********986 PP

2TCR49.49.3e-16169206239
                      TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                              ++kgC+Ckks ClkkYCeCf+a++ Cse+C C dCkN 
  Rsa1.0_00392.1_g00005.1 169 NNKGCRCKKSGCLKKYCECFQANVLCSENCGCLDCKNF 206
                              689**********************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.9E-1495135IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163434.11196208IPR005172CRC domain
PfamPF036382.1E-1097132IPR005172CRC domain
SMARTSM011143.9E-16168209IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.4E-12171206IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 496 aa     Download sequence    Send to blast
MSEGGGGGDF PPKKDGVSDD SGFPEKKPAR QLDFTGGLVE RSESKPAPTV VTPSVRIHPV  60
TSQSLQILNA PTKQPEESPK SRPKPVVEGR DGTPHKKKHC NCKLSRCLKL YCECFASGSY  120
CDGCNCANCF NNVDNEPARR VAVEATLDRN PNAFRPKIAT SPHGVMRDNN KGCRCKKSGC  180
LKKYCECFQA NVLCSENCGC LDCKNFDGSE ERRALFHGEH ADNMAYLQQA ANAAITGAVG  240
SSGFAPFPAP KRRKGLDISL NQANKDSSTY CLGQFQQESN GRTIGPTSAT SPAKFVYRSL  300
LAEIIQPQDV KALCSVLVAV AGETTKTLTD KRIETEKRVE DQKETSLASS YNSQGDKDAS  360
DANMVADDGN QADSSKGKPL SPATLALMCD ERDTIFMVAA AEPNGSVEYS GGCGTNSQEQ  420
SEICAEQERM VLTKFRDCLY RLISYAEFKE SKCSYLARRH IQSPSTVPTV TVKTENGIQP  480
SSNHQKPPAL KEKKDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A6e-309721711132Protein lin-54 homolog
5fd3_B6e-309721711132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_00392.1_g00005.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018451421.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A3N6TNB90.0A0A3N6TNB9_BRACR; Uncharacterized protein
STRINGBra010348.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein