PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00384.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 181aa    MW: 19534.1 Da    PI: 7.0967
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00384.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260124.64.9e-39111101100
                   DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqq 86 
                              +CaaCk+l+r+C++ C++ap+f ++++ +fa vhk+FGasnv+kll+++pee+r+++++sl+yeA++r++dPvyG++g i +lq++
  Rsa1.0_00384.1_g00001.1  11 SCAACKLLKRRCTPTCIFAPHFRSSDQMTFAKVHKVFGASNVSKLLSEVPEEQRQETVNSLAYEADVRLKDPVYGCIGAIASLQKK 96 
                              6************************************************************************************* PP

                   DUF260  87 leqlkaelallkee 100
                              + +l++++a+++++
  Rsa1.0_00384.1_g00001.1  97 MLELQHDIAVARSR 110
                              ********999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.55710111IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-3811108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MRGHEPRSSS SCAACKLLKR RCTPTCIFAP HFRSSDQMTF AKVHKVFGAS NVSKLLSEVP  60
EEQRQETVNS LAYEADVRLK DPVYGCIGAI ASLQKKMLEL QHDIAVARSR LLSAAHNNAG  120
GGGVNNNNSS NHVSSLSPLV DDSSPQLAAF LDLVPSYSDL MLLDGSGLDA YLFDIGQPPF  180
V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-4161216121LOB family transfactor Ramosa2.1
5ly0_B1e-4161216121LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_00384.1_g00001.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2546081e-131AC254608.1 Capsella rubella clone CAP16-D12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018488521.11e-132PREDICTED: LOB domain-containing protein 21
SwissprotQ9SRL82e-97LBD21_ARATH; LOB domain-containing protein 21
TrEMBLA0A078F5A91e-102A0A078F5A9_BRANA; BnaA05g27870D protein
TrEMBLA0A397ZEE11e-102A0A397ZEE1_BRACM; Uncharacterized protein
STRINGBra034867.1-P1e-101(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM102552735
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.11e-81LOB domain-containing protein 21
Publications ? help Back to Top
  1. Weber AP,Weber KL,Carr K,Wilkerson C,Ohlrogge JB
    Sampling the Arabidopsis transcriptome with massively parallel pyrosequencing.
    Plant Physiol., 2007. 144(1): p. 32-42
    [PMID:17351049]