PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00362.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WRKY
Protein Properties Length: 399aa    MW: 44528.9 Da    PI: 6.878
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00362.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.31.6e-33220278159
                              ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                     WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                              ldDgy+WrKYGqK vk+s++prsYYrCt+ gC vkk+vers++dp++v +tYeg+H h+
  Rsa1.0_00362.1_g00001.1 220 LDDGYRWRKYGQKAVKNSPYPRSYYRCTTVGCGVKKRVERSSDDPSIVMTTYEGQHSHP 278
                              59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.9E-34205280IPR003657WRKY domain
SuperFamilySSF1182901.03E-29213280IPR003657WRKY domain
PROSITE profilePS5081132.845215280IPR003657WRKY domain
SMARTSM007743.6E-40220279IPR003657WRKY domain
PfamPF031066.5E-27221278IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MEKKIEQHQK EQLNSTKNTE TKIEHQEQQS QASSSSSHMA NLATSSDHHL HQLELAGNNI  60
NLSSIFDTPI SLPFPYSYFE DHPSNNPNSF LDLLRQDQHQ FASSSNPSSF SFDAFPLQNS  120
NDTNLFFTDL PLPQPVTTKA ESSEVVNTAP TSPNSTSVSS SSNEAANDNT NKEVAVKDQV  180
EGDQQEHKGT KPQLKAKKKN QKKAREARFA FLTKSDIDNL DDGYRWRKYG QKAVKNSPYP  240
RSYYRCTTVG CGVKKRVERS SDDPSIVMTT YEGQHSHPFP MTPRGHIGML TSPILDHGAT  300
TASSSSFSIP QPRYLLTQHH QPYNSMYNTS LSMINRSSPN GTFINPGPSS FPGFGYDHMP  360
QASTSTTSAI RDHGLLQDIL PSQIREDTIN TQINEEDKK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A9e-282132801077Probable WRKY transcription factor 4
2lex_A9e-282132801077Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_00362.1_g00001.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4300590.0KF430059.1 Brassica rapa WRKY transcription factor 48 (WRKY48) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018485307.10.0PREDICTED: probable WRKY transcription factor 48
SwissprotQ9FGZ41e-173WRK48_ARATH; Probable WRKY transcription factor 48
TrEMBLA0A3P5YKI80.0A0A3P5YKI8_BRACM; Uncharacterized protein
TrEMBLM4D0N30.0M4D0N3_BRARP; Uncharacterized protein
STRINGBra010032.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56242648
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49520.11e-149WRKY DNA-binding protein 48
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]