PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00311.1_g00013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WRKY
Protein Properties Length: 576aa    MW: 64139.3 Da    PI: 8.8995
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00311.1_g00013.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY25.52.7e-08181202223
                              --SS-EEEEEEE--TT-SS-EE CS
                     WRKY   2 dDgynWrKYGqKevkgsefprs 23 
                              +Dgy+WrKYGqK vk+++   s
  Rsa1.0_00311.1_g00013.1 181 EDGYRWRKYGQKAVKNKTKRSS 202
                              8**************9866544 PP

2WRKY53.54.7e-174564922359
                              EEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                     WRKY  23 sYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                              sYYrCt+++C+vkk+vers +dp+vv++tYe++Hnh+
  Rsa1.0_00311.1_g00013.1 456 SYYRCTTQKCNVKKRVERSYQDPTVVITTYESQHNHP 492
                              9***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.8E-10165204IPR003657WRKY domain
SuperFamilySSF1182905.62E-7173204IPR003657WRKY domain
PROSITE profilePS5081110.085175204IPR003657WRKY domain
SMARTSM007740.0074180224IPR003657WRKY domain
PfamPF031063.2E-5181204IPR003657WRKY domain
SMARTSM007743.7E-9445493IPR003657WRKY domain
SuperFamilySSF1182902.35E-13455494IPR003657WRKY domain
PfamPF031063.6E-11455492IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.0E-15456494IPR003657WRKY domain
PROSITE profilePS5081117.959456494IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 576 aa     Download sequence    Send to blast
MSNETKDLNN HHHTSSYNHY NDISNQNILN LPYVSGPSSY NANMISSQIG YDLQSSPQGV  60
YESGFELSPS FTEFFSSSFD QENGFYNAFN YNTSNKSQEV VGSGGAIIES KTRGSASPSS  120
SEADHHHGED SGNSLRKREA DDGGKDDQRA QKEVKTKRKE EKKQREPRVS FVTKTEVEHL  180
EDGYRWRKYG QKAVKNKTKR SSKYHQHILS LLSLHVVAAV NHHRLLFISF LTFFTFLFCL  240
TLFSSSLHSA ATTSHSLSSS PPSSSLSPPI LAALLHYTSS SPPNTSMSLP ELSAVSTVIN  300
SLRDAQLRPQ TPLPHRDLSV LPPLLRLPYP PHEPPINLCD SFSSAAVSIA ASAPSGTPSS  360
APGLRSHTEI SLSQPLAPSS STYASSATPS LPPPLHSLLL HHIRRHHRLL PRHLPSLLLL  420
RSQPRRLPLS PPLPFGDDGG DVAHTLLHNG LARDWSYYRC TTQKCNVKKR VERSYQDPTV  480
VITTYESQHN HPIPTSRRSA MFAGPASSNY NSTSLSSVSD FIINTPRSFS RDDLFRAPYA  540
SVNENPNYQQ QQNQELQHDY ELLKDMFPSV FFKHEP
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-TTGAC[CT]-3'), a frequently occurring stress-responsive cis-acting element. Functions as positive regulator of salt stress response. Binds the W box of LTI78/RD29A stress-response gene and directly regulates its transcription under salt stress. Functions antagonistically with VQ9 to regulate sodium and potassium homeostasis under salt stress by regulating the expression of downstream SOS (SALT OVERLY SENSITIVE) stress-responsive genes. The DNA-binding activity of WRKY8 is decreased by VQ9 (PubMed:23451802). Functions as negative regulator of basal resistance to the bacterial pathogen P. syringae and as positive regulator of resistance to the fungal pathogen to B. cinerea (PubMed:20367464). Functions as positive regulator of defense response againt tobamovirus (TMV) by regulating both the abscisic acid and ethylene signaling pathways. Positively regulates ABI4 expression and negatively modulates ACS6 and ERF104 expression by directly binding to the W box consensus motifs within their promoters (PubMed:23650359). {ECO:0000269|PubMed:20367464, ECO:0000269|PubMed:23451802, ECO:0000269|PubMed:23650359}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_00311.1_g00013.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By wounding, abscisic acid (ABA), salicylic acid (SA), H(2)O(2), and infection with P.syringae pv. tomato DC3000 and B.cinerea (PubMed:20367464). Induced by salt stress (PubMed:23451802). {ECO:0000269|PubMed:20367464, ECO:0000269|PubMed:23451802}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC2465690.0KC246569.1 Brassica napus WRKY transcription factor 8.1 (WRKY8.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018481874.11e-122PREDICTED: probable WRKY transcription factor 8
SwissprotQ9FL261e-83WRKY8_ARATH; WRKY transcription factor 8
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15242693
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46350.14e-64WRKY DNA-binding protein 8
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Sukweenadhi J, et al.
    Paenibacillus yonginensis DCY84(T) induces changes in Arabidopsis thaliana gene expression against aluminum, drought, and salt stress.
    Microbiol. Res., 2015. 172: p. 7-15
    [PMID:25721473]