PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00302.1_g00018.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TCP
Protein Properties Length: 263aa    MW: 28230.5 Da    PI: 10.1045
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00302.1_g00018.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP124.61.1e-38422262120
                      TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsss 87 
                              a+kk + +++h+kv+gR+RR+R+++ caar+F+L++eLG+++d++tieWLl+qa+p+i+++tgt++++as+++a+ s+  +s   +
  Rsa1.0_00302.1_g00018.1  42 AVKKPPAKDRHSKVDGRGRRIRMPIICAARVFQLTRELGHKSDGQTIEWLLRQAEPSIIAATGTGTTPASFSTASVSVRGNS-TVI 126
                              789*************************************************************999997773333332222.222 PP

                      TCP  88 g...................................................................kaaksaa.kskksqksaa 105
                              +                                                                   + a +++  ++++q++aa
  Rsa1.0_00302.1_g00018.1 127 SasancalssssldhkpppllgsspfilgkrlrgdddsgkeetmgsfatpagfwavparqdfgqvwsfA-AHQEMfLQQQQQQPAA 211
                              233445555666677778888888888888888888888888889999999999999999999998844.4444436777777777 PP

                      TCP 106 salnlakesrakara 120
                              +al ++++++++a +
  Rsa1.0_00302.1_g00018.1 212 AALFVHQQQQQQAAM 226
                              667777666655544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.9E-3448195IPR005333Transcription factor, TCP
PROSITE profilePS5136927.89248102IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MSNNNNEGVM ISNGSLIEHQ RQHQQQQQQL NQKQSSDGGA LAVKKPPAKD RHSKVDGRGR  60
RIRMPIICAA RVFQLTRELG HKSDGQTIEW LLRQAEPSII AATGTGTTPA SFSTASVSVR  120
GNSTVISASA NCALSSSSLD HKPPPLLGSS PFILGKRLRG DDDSGKEETM GSFATPAGFW  180
AVPARQDFGQ VWSFAAHQEM FLQQQQQQPA AAALFVHQQQ QQQAAMGEAS AARVGNYLPG  240
HLNLLASLSG GAPGSGRRED DQR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00524DAPTransfer from AT5G23280Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_00302.1_g00018.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0076482e-34AB007648.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MKD15.
GenBankAK1186792e-34AK118679.1 Arabidopsis thaliana At5g23280 mRNA for unknown protein, complete cds, clone: RAFL19-95-A03.
GenBankCP0026882e-34CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018485264.11e-164PREDICTED: transcription factor TCP7-like
RefseqXP_018485265.11e-164PREDICTED: transcription factor TCP7-like
RefseqXP_018485270.11e-164PREDICTED: transcription factor TCP7-like
RefseqXP_018485271.11e-164PREDICTED: transcription factor TCP7-like
SwissprotQ9FMX21e-112TCP7_ARATH; Transcription factor TCP7
TrEMBLA0A3P6ET611e-140A0A3P6ET61_BRAOL; Uncharacterized protein
STRINGBo7g097790.11e-139(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17822685
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23280.19e-63TCP family protein