PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00285.1_g00018.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 570aa    MW: 63387.9 Da    PI: 4.198
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00285.1_g00018.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.64.9e-53101371128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              l+pGfrFhPtdeelv +yLk+kv +k+++l ++i+ +d+yk+ePwdLp k k+k+++ ewyfFs  dkky++g+++nrat++gyWk
  Rsa1.0_00285.1_g00018.1  10 LAPGFRFHPTDEELVRYYLKRKVCNKPFKL-DAISVTDVYKSEPWDLPdKsKLKSRDLEWYFFSMLDKKYNNGSKTNRATEKGYWK 94 
                              579***************************.99**************95347777888**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              +tgkd+e+ + ++++vg+kktLv++kgrap+ge+t+Wvmheyrl
  Rsa1.0_00285.1_g00018.1  95 TTGKDREIRN-GSRAVGMKKTLVYHKGRAPRGERTNWVMHEYRL 137
                              *********9.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.02E-628160IPR003441NAC domain
PROSITE profilePS5100558.28810160IPR003441NAC domain
PfamPF023654.8E-2812137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 570 aa     Download sequence    Send to blast
MGRGSATSTL APGFRFHPTD EELVRYYLKR KVCNKPFKLD AISVTDVYKS EPWDLPDKSK  60
LKSRDLEWYF FSMLDKKYNN GSKTNRATEK GYWKTTGKDR EIRNGSRAVG MKKTLVYHKG  120
RAPRGERTNW VMHEYRLTDD ELKKTGAPQD AFVLCRIFQK SGTGPKNGEQ YGAPYLEEEW  180
EEDKMTFVPE QDALSSEVLA FDDDDVYLDI DDFDEKPENL VVYDAIPVEP NYFHGESSNN  240
VESGNYSDSG NYIQPENFAV DSGGCFEQPL EAFEEDQKPI IRDGSIQPCS MFPNEQSGCG  300
VQDESAVNLE TSNSNVFAGG NCYSDIPIDT NYIMPDDSFI DPSNNLPLGD DLFLETDELG  360
SALPDDFDFE DYLNFFDDVD AQNMTLDVSQ LLESEEAVPA QEGHDQIPSS EDLENEGTGG  420
KVVVEKDETG EGSSSKQDAD VVTDFDSASK YPFLKKAGQM CGATSSFASQ FQTKDARLHA  480
GQSSGSVHVT AGIIRISNTT LAADMGWSYD KNDNLNVVLS FGLVQQRDDG MSSSVNKTGV  540
PATRAMLIFL CLWVLLLSVS FKVATMVSAR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-45916616171NO APICAL MERISTEM PROTEIN
1ut4_B3e-45916616171NO APICAL MERISTEM PROTEIN
1ut7_A3e-45916616171NO APICAL MERISTEM PROTEIN
1ut7_B3e-45916616171NO APICAL MERISTEM PROTEIN
4dul_A3e-45916616171NAC domain-containing protein 19
4dul_B3e-45916616171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). Transcripition activator associated with the induction of genes related to flavonoid biosynthesis and required for the accumulation of anthocyanins in response to high light stress (PubMed:19887540). Plays a role in the regulation of 20S and 26S proteasomes in response to high light stress (PubMed:21889048). {ECO:0000250|UniProtKB:Q949N0, ECO:0000269|PubMed:19887540, ECO:0000269|PubMed:21889048}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_00285.1_g00018.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By exposure to high light (PubMed:19887540). Induced by heat and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:19887540}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018476112.10.0PREDICTED: NAC domain-containing protein 78-like isoform X2
SwissprotQ84K000.0NAC78_ARATH; NAC domain-containing protein 78
TrEMBLA0A078J3K90.0A0A078J3K9_BRANA; BnaC03g71220D protein
STRINGBo3g002800.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31922762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.10.0NAC domain containing protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Liang M, et al.
    Subcellular Distribution of NTL Transcription Factors in Arabidopsis thaliana.
    Traffic, 2015. 16(10): p. 1062-74
    [PMID:26201836]
  4. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  5. Gladman NP,Marshall RS,Lee KH,Vierstra RD
    The Proteasome Stress Regulon Is Controlled by a Pair of NAC Transcription Factors in Arabidopsis.
    Plant Cell, 2016. 28(6): p. 1279-96
    [PMID:27194708]
  6. Tang Y,Zhao CY,Tan ST,Xue HW
    Arabidopsis Type II Phosphatidylinositol 4-Kinase PI4Kγ5 Regulates Auxin Biosynthesis and Leaf Margin Development through Interacting with Membrane-Bound Transcription Factor ANAC078.
    PLoS Genet., 2016. 12(8): p. e1006252
    [PMID:27529511]