PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00222.1_g00012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 373aa    MW: 41467.5 Da    PI: 6.512
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00222.1_g00012.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.91.4e-10146203562
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                              kr++r + NR +A rs +RK  +i eLe+kv++L++e ++L  +l+  +     l se
  Rsa1.0_00222.1_g00012.1 146 KRAKRIIANRQSAARSKERKARYIMELERKVQTLQTEATTLSAQLSLFQRDTTGLSSE 203
                              9*****************************************9999887776666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.6E-17142206IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.7E-8144199No hitNo description
PROSITE profilePS5021710.68144207IPR004827Basic-leucine zipper domain
PfamPF001702.0E-9146204IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.13E-10146197No hitNo description
CDDcd147032.02E-22147196No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MEDSSNAKSN NQCPPPQQPL ATNPSPTPFR GPYHRRAHSE VQFRLPEDLD LSEPFGGFEE  60
LGSEDDIFCT YMDIEKLGSG SDSAPRSDNP FSGENVGGGE EGGSSSRTRH RHSLSVDGGS  120
SSLESIEAKK AMAPDKLAEL WVVDPKRAKR IIANRQSAAR SKERKARYIM ELERKVQTLQ  180
TEATTLSAQL SLFQRDTTGL SSENTELKLR LQVMEQQAKL RDALNDQLKK EVERLKFATG  240
EASHTDAYNL GMAHMQYAQH QPQQQSFFQQ QHHHHQQQTD AQNLQQMTHQ FHLFQPNNNN  300
NNNQNPNVTS AATRQNPQLM HQAGSNPSAQ SHSFAEAMHE DPLGRLQGLD ISSCGRGSSF  360
GRSDAVSESS STM
Functional Description ? help Back to Top
Source Description
UniProtTranscrition factor that may participate with bZIP34 in the gametophytic control of pollen development. {ECO:0000269|PubMed:27896439}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_00222.1_g00012.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0742691e-174AY074269.1 Arabidopsis thaliana putative bZIP transcription factor (At2g40620) mRNA, complete cds.
GenBankAY0967461e-174AY096746.1 Arabidopsis thaliana putative bZIP transcription factor (At2g40620) mRNA, complete cds.
GenBankZ860931e-174Z86093.1 A.thaliana mRNA for b-Zip DNA binding protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018441811.10.0PREDICTED: transcription factor RF2b
RefseqXP_018441812.10.0PREDICTED: transcription factor RF2b
SwissprotO228730.0BZP18_ARATH; bZIP transcription factor 18
TrEMBLA0A397Z5T60.0A0A397Z5T6_BRACM; Uncharacterized protein
STRINGBra004582.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40422757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.11e-173bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Pawar V, et al.
    A novel family of plant nuclear envelope-associated proteins.
    J. Exp. Bot., 2016. 67(19): p. 5699-5710
    [PMID:27630107]
  3. Gibalová A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  5. Babiychuk E,Fuangthong M,Van Montagu M,Inzé D,Kushnir S
    Efficient gene tagging in Arabidopsis thaliana using a gene trap approach.
    Proc. Natl. Acad. Sci. U.S.A., 1997. 94(23): p. 12722-7
    [PMID:9356517]