PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00191.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TCP
Protein Properties Length: 387aa    MW: 42341.2 Da    PI: 10.1394
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00191.1_g00007.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP35.63.2e-114069231
                      TCP  2 agkkdrhskihTkvggRdRRvRlsaecaar 31
                              g+kdrhsk+ T++g+RdRRvRls+++a +
  Rsa1.0_00191.1_g00007.1 40 SGGKDRHSKVWTSKGPRDRRVRLSVSTALQ 69
                             689************************965 PP

2TCP117.51.7e-36702046135
                      TCP   6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssg... 88 
                               rhsk+ T++g+RdRRvRls+++a +f+dLqd+LG+d++sk++eWL+++a+ +i el+++ ++++  +++++++ ++ +  s+   
  Rsa1.0_00191.1_g00007.1  70 XRHSKVWTSKGPRDRRVRLSVSTALQFYDLQDRLGLDQPSKAVEWLIKAAEDSISELPSL-NNTNFPMTDDDDQIQTVTGASPapa 154
                              79**********************************************************.4444344444444444433333567 PP

                      TCP  89 .kaaksaa.kskksqksaasalnlak.esrakarararertrekmriknk 135
                               + a+++a +s++++++++s l+l++ e r kar+rarert+++ + +++
  Rsa1.0_00191.1_g00007.1 155 pAPAAKSAcSSNSDTSKNSSGLSLSRsELRDKARERARERTAKETKERDH 204
                              744445554888888888889999999***************99988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036348.2E-114169IPR005333Transcription factor, TCP
PROSITE profilePS5136927.65968126IPR017887Transcription factor TCP subgroup
PfamPF036345.3E-3470201IPR005333Transcription factor, TCP
PROSITE profilePS5137010.205181202IPR017888CYC/TB1, R domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009637Biological Processresponse to blue light
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
GO:1903508Biological Processpositive regulation of nucleic acid-templated transcription
GO:2000306Biological Processpositive regulation of photomorphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MFPIIGDLMK TNNGDVVDNN NRLSRWHHNS SRIIRVSRAS GGKDRHSKVW TSKGPRDRRV  60
RLSVSTALQX RHSKVWTSKG PRDRRVRLSV STALQFYDLQ DRLGLDQPSK AVEWLIKAAE  120
DSISELPSLN NTNFPMTDDD DQIQTVTGAS PAPAPAPAAK SACSSNSDTS KNSSGLSLSR  180
SELRDKARER ARERTAKETK ERDHHTTTTT GSFTDLLNSG SVPVNINRQW MAPSSSPAQM  240
EYLSSGLILG SGQTHFPNAH PFPDHPHHQE FSFVPDHLIS PAGSNGGGAF NLDFNMSTTS  300
GAGTAVTSSA GFSGFNRGTL QSNSANHHHQ QSFLANLQRF SSSEGGGGPQ FLFGALPAEN  360
HHHNNHQFQL YYENGCRNSD QKGKGKN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A1e-2273127155Putative transcription factor PCF6
5zkt_B1e-2273127155Putative transcription factor PCF6
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Participates in ovule develpment (PubMed:25378179). Participates in ovule develpment (PubMed:25378179). Promotes light-regulated transcription of CHS, CAB, HYH and HY5. Regulates positively photomorphogenesis (e.g. hypocotyl elongation inhibition and cotyledon opening in response to blue light) (PubMed:26596765). {ECO:0000269|PubMed:12931144, ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179, ECO:0000269|PubMed:26596765}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00006PBMTransfer from 493022Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_00191.1_g00007.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the miRNA miR-JAW (PubMed:12931144). Induced by blue light. Stabilized by light but labile in darkness due to proteasome-dependent proteolysis (at protein level) (PubMed:26596765). {ECO:0000269|PubMed:12931144, ECO:0000269|PubMed:26596765}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895531e-156AC189553.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH006A08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018456703.10.0PREDICTED: transcription factor TCP2-like
SwissprotQ93V431e-172TCP2_ARATH; Transcription factor TCP2
TrEMBLA0A078J9T50.0A0A078J9T5_BRANA; BnaC01g40850D protein
TrEMBLA0A0D3A4310.0A0A0D3A431_BRAOL; Uncharacterized protein
STRINGBo1g019520.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM76152539
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18390.21e-129TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 2
Publications ? help Back to Top
  1. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]
  2. Bresso EG,Chorostecki U,Rodriguez RE,Palatnik JF,Schommer C
    Spatial Control of Gene Expression by miR319-Regulated TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2018. 176(2): p. 1694-1708
    [PMID:29133375]