PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00181.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CPP
Protein Properties Length: 308aa    MW: 34004.2 Da    PI: 8.9808
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00181.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR42.61.2e-135485940
                      TCR  9 kkskClkkYCeCfaagkkCseeCkCedCkNke 40
                             k +kClk+YCeCf+ag++C e C+C dC+Nk 
  Rsa1.0_00181.1_g00004.1 54 KSQKCLKLYCECFSAGVYCIEPCSCVDCFNKP 85
                             6789**************************96 PP

2TCR55.41.2e-17133170239
                      TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                              +k+gCnCkks+ClkkYCeCf++g+ Cs +C+Ce+CkN 
  Rsa1.0_00181.1_g00004.1 133 HKRGCNCKKSNCLKKYCECFQSGVGCSINCRCEGCKNA 170
                              799**********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5163434.01947172IPR005172CRC domain
SMARTSM011141.9E-105387IPR033467Tesmin/TSO1-like CXC domain
PfamPF036386.2E-105484IPR005172CRC domain
SMARTSM011141.4E-16132173IPR033467Tesmin/TSO1-like CXC domain
PfamPF036388.8E-13134170IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MISKLCVDNK AESSPKHVAL GIDLHLNAIA MSSRDRPGLS KLERVIHVSD ATAKSQKCLK  60
LYCECFSAGV YCIEPCSCVD CFNKPIHEDT VLATRKQIES RNPLAFAPKV IRNSDSITEV  120
GEDASKTPAS APHKRGCNCK KSNCLKKYCE CFQSGVGCSI NCRCEGCKNA FGRKDACLLA  180
IMESKQEEDH KTYEKRPSKI QENKQVEQNP SSDQPSTPLP PYRHLMVHQP FFSKNRLPPT  240
QFFLGVEKTE ILSINPITTI KAISPNSKRV SPPQLGSSGT GSILVKRSDG RKLILRSIPA  300
FPSLNPNQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A3e-135816921120Protein lin-54 homolog
5fd3_B3e-135816921120Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable floral-specific cell division component, required for proper organ formation in flowers. Regulates the floral meristem cell division and the inflorescence meristem organization. Plays a role in development of both male and female reproductive tissues. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:9043081, ECO:0000269|PubMed:9725857}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_00181.1_g00004.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2040591e-162AF204059.1 Arabidopsis thaliana CXC domain protein TSO1 (TSO1) mRNA, complete cds.
GenBankAF2063241e-162AF206324.1 Arabidopsis thaliana putative DNA binding protein (tso1) mRNA, tso1-3 allele, complete cds.
GenBankAY0460191e-162AY046019.1 Arabidopsis thaliana putative DNA binding protein (At3g22780) mRNA, complete cds.
GenBankAY1426421e-162AY142642.1 Arabidopsis thaliana putative DNA binding protein (At3g22780) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006406129.11e-147CRC domain-containing protein TSO1
SwissprotQ9LUI31e-143TSO1_ARATH; CRC domain-containing protein TSO1
TrEMBLA0A3P6G5981e-149A0A3P6G598_BRAOL; Uncharacterized protein
STRINGBostr.19424s0382.1.p1e-147(Boechera stricta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.11e-146Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Lu T,Dou Y,Zhang C
    Fuzzy clustering of CPP family in plants with evolution and interaction analyses.
    BMC Bioinformatics, 2013. 14 Suppl 13: p. S10
    [PMID:24268301]
  2. Xie W, et al.
    Exploring potential new floral organ morphogenesis genes of Arabidopsis thaliana using systems biology approach.
    Front Plant Sci, 2015. 6: p. 829
    [PMID:26528302]
  3. Wang W,Sijacic P,Xu P,Lian H,Liu Z
    Arabidopsis TSO1 and MYB3R1 form a regulatory module to coordinate cell proliferation with differentiation in shoot and root.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(13): p. E3045-E3054
    [PMID:29535223]