PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00154.1_g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WRKY
Protein Properties Length: 320aa    MW: 36334.9 Da    PI: 8.5146
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00154.1_g00020.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.26.9e-33178235259
                              --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                     WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                              +Dgy+WrKYGqK vk+s++prsYYrCt+++C+vkk+vers +dp+vv++tYe++Hnh+
  Rsa1.0_00154.1_g00020.1 178 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCNVKKRVERSYQDPTVVITTYESQHNHP 235
                              8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381306.7E-981320IPR017396PWRKY transcription factor, group IIc
Gene3DG3DSA:2.20.25.801.1E-34162237IPR003657WRKY domain
SuperFamilySSF1182905.49E-29169237IPR003657WRKY domain
PROSITE profilePS5081132.282172237IPR003657WRKY domain
SMARTSM007746.1E-38177236IPR003657WRKY domain
PfamPF031062.0E-25178235IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0051607Biological Processdefense response to virus
GO:0070301Biological Processcellular response to hydrogen peroxide
GO:1901002Biological Processpositive regulation of response to salt stress
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MSNETKDLNN NHYTSSYNHY NSIDSQNMFL PYVSGPCTYD ANMISSQIGS DLSSSHGANG  60
FGFYPSPSST EFFNPSIDQE NGFCNAYNYN TSLKSHEVVG GGGAIIENET RLSASPSSSE  120
AGRYLGKDSG KSLMKREADD GGDEQRSQKV VKAKKNQEKK IREPRVSFMT KTEVDHLEDG  180
YRWRKYGQKA VKNSPYPRSY YRCTTQKCNV KKRVERSYQD PTVVITTYES QHNHPIPTTR  240
RTAMFPGPAA SDYKSSSLSP VSNFINTPRS FSHDDLFRVP HSSVNANPYY QQQQNHEFQH  300
DSDYKLLKEM FPSVFFKQEP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-28167237777Probable WRKY transcription factor 4
2lex_A5e-28167237777Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-TTGAC[CT]-3'), a frequently occurring stress-responsive cis-acting element. Functions as positive regulator of salt stress response. Binds the W box of LTI78/RD29A stress-response gene and directly regulates its transcription under salt stress. Functions antagonistically with VQ9 to regulate sodium and potassium homeostasis under salt stress by regulating the expression of downstream SOS (SALT OVERLY SENSITIVE) stress-responsive genes. The DNA-binding activity of WRKY8 is decreased by VQ9 (PubMed:23451802). Functions as negative regulator of basal resistance to the bacterial pathogen P. syringae and as positive regulator of resistance to the fungal pathogen to B. cinerea (PubMed:20367464). Functions as positive regulator of defense response againt tobamovirus (TMV) by regulating both the abscisic acid and ethylene signaling pathways. Positively regulates ABI4 expression and negatively modulates ACS6 and ERF104 expression by directly binding to the W box consensus motifs within their promoters (PubMed:23650359). {ECO:0000269|PubMed:20367464, ECO:0000269|PubMed:23451802, ECO:0000269|PubMed:23650359}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00545DAPTransfer from AT5G46350Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_00154.1_g00020.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By wounding, abscisic acid (ABA), salicylic acid (SA), H(2)O(2), and infection with P.syringae pv. tomato DC3000 and B.cinerea (PubMed:20367464). Induced by salt stress (PubMed:23451802). {ECO:0000269|PubMed:20367464, ECO:0000269|PubMed:23451802}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9124180.0EU912418.1 Brassica napus WRKY8-1 transcription factor (WRKY8-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018456683.10.0PREDICTED: probable WRKY transcription factor 8
SwissprotQ9FL261e-150WRKY8_ARATH; WRKY transcription factor 8
TrEMBLA0A3P5YJR90.0A0A3P5YJR9_BRACM; WRKY transcription factor
TrEMBLC4N0Y10.0C4N0Y1_BRANA; WRKY transcription factor
STRINGBra017561.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15242693
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46350.11e-135WRKY DNA-binding protein 8
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Sukweenadhi J, et al.
    Paenibacillus yonginensis DCY84(T) induces changes in Arabidopsis thaliana gene expression against aluminum, drought, and salt stress.
    Microbiol. Res., 2015. 172: p. 7-15
    [PMID:25721473]