PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00119.1_g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family BES1
Protein Properties Length: 276aa    MW: 30006.5 Da    PI: 8.05
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00119.1_g00020.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822206.67e-6421351146
                   DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssa 86 
                              ++++r+ptwkErEnnkrRERrRRaiaaki++GLR +Gn+klpk++DnneVlkALc+eAGw+ve+DGttyrkg+kpl+++e +  s+
  Rsa1.0_00119.1_g00020.1   2 TSGTRTPTWKERENNKRRERRRRAIAAKIFTGLRIHGNFKLPKHCDNNEVLKALCNEAGWTVEEDGTTYRKGCKPLDRTELMIGST 87 
                              5899********************************************************************************** PP

                   DUF822  87 saspesslqsslkssalaspvesysaspksssfpspssldsislasaasllpvlsvlslv 146
                              sasp+ss+q        +sp++sy++sp+sssfpsp++    +  +a+sl+p+l++ls+ 
  Rsa1.0_00119.1_g00020.1  88 SASPCSSYQ--------PSPRASYNPSPSSSSFPSPTN----PFGDANSLIPWLKNLSSN 135
                              *********........*******************98....56677899****999763 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056874.3E-603132IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MTSGTRTPTW KERENNKRRE RRRRAIAAKI FTGLRIHGNF KLPKHCDNNE VLKALCNEAG  60
WTVEEDGTTY RKGCKPLDRT ELMIGSTSAS PCSSYQPSPR ASYNPSPSSS SFPSPTNPFG  120
DANSLIPWLK NLSSNSPSKL PFFHGNSISA PVTPPLARSP TYDQVTIPDS GWLSGMQTPQ  180
SGPSSPTFSL VSRNPFFDKE AFKMGDCSSP MWTPGQSGNC SPAIPAGVDQ NSDVPMADGI  240
AAEFAFGMVK PWEGERIHGE CVSDDLELTL GNSRTS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0245120.0BT024512.1 Arabidopsis thaliana At4g18890 mRNA, complete cds.
GenBankAY0883790.0AY088379.1 Arabidopsis thaliana clone 6321 mRNA, complete sequence.
GenBankAK1188500.0AK118850.1 Arabidopsis thaliana At4g18890 mRNA for unknown protein, complete cds, clone: RAFL21-18-A16.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013737420.11e-170PREDICTED: BES1/BZR1 homolog protein 3
SwissprotO494041e-169BEH3_ARATH; BES1/BZR1 homolog protein 3
TrEMBLA0A078EC661e-170A0A078EC66_BRANA; BnaA03g43770D protein
STRINGBra012570.1-P1e-168(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18890.11e-150BES1/BZR1 homolog 3