PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00101.1_g00035.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bHLH
Protein Properties Length: 185aa    MW: 21180.2 Da    PI: 8.0882
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00101.1_g00035.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH45.61.3e-142576255
                             HHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
                      HLH  2 rrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
                             + +h e+E++RR+++ s ++ Lr+llP  +   +++ s ++ L +Av+YI++Lq
  Rsa1.0_00101.1_g00035.1 25 KIMHREVEKQRRQEMASLYASLRSLLPLEF--IQGRRSTSDQLNEAVNYINHLQ 76
                             568*************************65..*********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088813.6052375IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474597.72E-142390IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000834.64E-102580No hitNo description
PfamPF000101.3E-112676IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.101.1E-112790IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003531.7E-62981IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MADFPEKGRK RRKEARVGNE ENMEKIMHRE VEKQRRQEMA SLYASLRSLL PLEFIQGRRS  60
TSDQLNEAVN YINHLQRNIK DMSSKRDDLM LLSGQSFESR NEQSRNDNSN HVVIRPCLVG  120
VEIVFSVLQT PLSSVLHVLS EYGLCVIGCI SSNVNGRLIH TLQAEVNDLA LVDFADLKVY  180
LLRLP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1813RKRRKE
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_00101.1_g00035.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018480741.11e-133PREDICTED: transcription factor bHLH118-like
SwissprotQ9STJ71e-83BH118_ARATH; Transcription factor bHLH118
TrEMBLA0A078IIB11e-121A0A078IIB1_BRANA; BnaA03g47370D protein
TrEMBLA0A397L1941e-121A0A397L194_BRACM; Uncharacterized protein
TrEMBLM4DRM41e-121M4DRM4_BRARP; Uncharacterized protein
STRINGBra019167.1-P1e-122(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44792754
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25400.15e-86bHLH family protein