PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00092.1_g00072.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WRKY
Protein Properties Length: 559aa    MW: 61136.2 Da    PI: 6.0954
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00092.1_g00072.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY79.63.4e-25293349259
                              --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                     WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                              +DgynWrKYGqK+vk+ + +rsYYrCt+++C++kk +e+s++ +k+v+i+ +g H+he
  Rsa1.0_00092.1_g00072.1 293 RDGYNWRKYGQKQVKSPKGSRSYYRCTYSECCAKK-IECSNDSGKMVQIVTKGLHTHE 349
                              6********************************98.*********************8 PP

2WRKY99.91.5e-31452508359
                              -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                     WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                              Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++ e++++v+itY+geHnh+
  Rsa1.0_00092.1_g00072.1 452 DGYRWRKYGQKMVKGNPNPRNYYRCTSAGCPVRKHIETAVENTRAVVITYKGEHNHD 508
                              9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1182901.57E-19290351IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.1E-20290351IPR003657WRKY domain
SMARTSM007743.8E-23292350IPR003657WRKY domain
PROSITE profilePS5081117.041294351IPR003657WRKY domain
PfamPF031064.0E-17294349IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.3E-31436510IPR003657WRKY domain
SuperFamilySSF1182906.54E-27444510IPR003657WRKY domain
PROSITE profilePS5081133.396445510IPR003657WRKY domain
SMARTSM007744.5E-36450509IPR003657WRKY domain
PfamPF031066.5E-24452508IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 559 aa     Download sequence    Send to blast
MEKSTQQTAK SEKVKPEKEL CDGLSQHRDE ESIGTIGDDM EDVHDVAIRE ILANDRVEDV  60
RENSPVEPND QDVREETDRS KKYVVSVVMP IVEVAVENSE VKTASSEPSM VEPSLSPAPS  120
AAKVQEGLLL LEQKSDHRLV NNLSVSPVLR TNSGKEDLVS VVDEVAVENC EVDTPPALTP  180
SSNPSVVDPL NPSAAKGQGL SLLEQKSVNN VSVSPVLRTD SGKEDVVSGV VPVDEVAVEN  240
REVETSPPGL TKSSDPSVVE PSLASGLSLL QRSYDSRVVR NLSVSPGLRT PPRDGYNWRK  300
YGQKQVKSPK GSRSYYRCTY SECCAKKIEC SNDSGKMVQI VTKGLHTHEP PRKSSFSPRE  360
IRAASAVTPV SEDDAVVATV PSDSTKENIC QSPTMVERKR HCENEAVEEP EPKRRQVLLN  420
KENTQSSVSV SKPGKKHRHV VHAADDVGIS GDGYRWRKYG QKMVKGNPNP RNYYRCTSAG  480
CPVRKHIETA VENTRAVVIT YKGEHNHDTP VPKKGHDTPS SVLLSPTSMR TRLEDQVNQC  540
SVGRESEKQS SEALDVVGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-25441511878Probable WRKY transcription factor 4
2lex_A5e-25441511878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM5931560.0KM593156.1 Brassica oleracea var. capitata WRKY transcription factor (WRKY82) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013648032.10.0PREDICTED: probable WRKY transcription factor 32
SwissprotP595831e-172WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLA0A0A7RCH40.0A0A0A7RCH4_BRAOC; WRKY82 protein
TrEMBLM4E5I10.0M4E5I1_BRARP; Uncharacterized protein
STRINGBra024035.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-165WRKY DNA-binding protein 32