PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00083.1_g00034.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NF-YA
Protein Properties Length: 430aa    MW: 48307.8 Da    PI: 6.7394
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00083.1_g00034.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA93.62.4e-29164219158
                CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                              +ep+YVNaKQy++Il+RR++Rak+e e+k+   +rkpylheSRhkhA+rR+R+sgGrF
  Rsa1.0_00083.1_g00034.1 164 QEPVYVNAKQYEGILRRRKARAKAELERKV--INRKPYLHESRHKHAMRRARASGGRF 219
                              69***************************9..89***********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.4E-31162222IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115234.587163222IPR001289Nuclear transcription factor Y subunit A
PfamPF020458.1E-26165219IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006168.7E-23166188IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860168188IPR018362CCAAT-binding factor, conserved site
PRINTSPR006168.7E-23196219IPR001289Nuclear transcription factor Y subunit A
Gene3DG3DSA:1.10.287.1101.7E-5367389IPR001623DnaJ domain
SuperFamilySSF465651.7E-5367388IPR001623DnaJ domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 430 aa     Download sequence    Send to blast
MQSKSGEGNE EEVNQQSDQQ QQQQQQQPMM MYPDPWWKNN SFGGGGGVLP QETPPSNSNG  60
ESESNDVHSP SEDGGDGPCK DSQAATSSSP LVDNHGVEGN DPTHDQQIVQ PPELVGHYIA  120
CVPNPYQDAY YGGMMGAYGH QPLGFRPYLG MPRERTALPL DMTQEPVYVN AKQYEGILRR  180
RKARAKAELE RKVINRKPYL HESRHKHAMR RARASGGRFA KKTEAEAEAA EDAAEAAAAG  240
RERERERCSA TNSSGSEQPV ETDSLVTMYK ESRVLLLGVS FGHRRQGNSQ NSLLSRILGV  300
FTKTAVENER RRENFFIELE VVFADVGTDG LLQQPCCTTM KGEALLMLEK YESSIKLCKQ  360
TMDLYLVLKA YREAALKHHP DKAAGQSLTR KETKDERLWK EEIEGWSSRR YPRRNCKYYL  420
QDISYANTPG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-15163232171NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1203212RHKHAMRRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0258011e-116BT025801.1 Arabidopsis thaliana At5g12840 mRNA, complete cds.
GenBankAK3172991e-116AK317299.1 Arabidopsis thaliana AT5G12840 mRNA, complete cds, clone: RAFL21-66-A21.
GenBankY137201e-116Y13720.1 Arabidopsis thaliana mRNA for Hap2a transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006399770.11e-128hypothetical protein EUTSA_v10014364mg
SwissprotQ9LXV51e-122NFYA1_ARATH; Nuclear transcription factor Y subunit A-1
TrEMBLV4LN101e-128V4LN10_EUTSA; Uncharacterized protein
STRINGBra023378.1-P1e-123(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59462646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.31e-85nuclear factor Y, subunit A1