PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00064.1_g00049.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WRKY
Protein Properties Length: 317aa    MW: 35701.6 Da    PI: 7.0642
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00064.1_g00049.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.72.4e-33155211258
                              --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
                     WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                              +Dgy+WrKYGqK vk+s+fprsYYrCt+a+C+vkk+vers +dp++v++tYeg+H+h
  Rsa1.0_00064.1_g00049.1 155 EDGYRWRKYGQKAVKNSPFPRSYYRCTTASCNVKKRVERSFRDPSTVVTTYEGQHTH 211
                              8******************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381307.3E-1151317IPR017396PWRKY transcription factor, group IIc
Gene3DG3DSA:2.20.25.807.1E-34139213IPR003657WRKY domain
SuperFamilySSF1182901.57E-28146212IPR003657WRKY domain
PROSITE profilePS5081130.963149214IPR003657WRKY domain
SMARTSM007741.0E-38154213IPR003657WRKY domain
PfamPF031067.0E-26155211IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MEFTSFHQAS LQSIWDFGEA ETDSLGFMEL LGSQNHSLLL ETLQPQTQPF EKMSSSELTI  60
LQAPPSKATA DNHVTSKVES LCSDINPPAT PNSSSISSAS SEAVNEEKSK REEDEEHQQK  120
KSDTNKQLKP KKNSQKRQRE ARVAFMTKSE VDHLEDGYRW RKYGQKAVKN SPFPRSYYRC  180
TTASCNVKKR VERSFRDPST VVTTYEGQHT HISPLTSRPI SSGGFFFGSS GVASNLGNFG  240
FPMESSTLMY PQFQQLVHFN QQQQQQELVR CFGGVGEYVT RHADAYGDDE RVKKSRGLVK  300
DNGLLQDVVP SHMLKEE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-28144214777Probable WRKY transcription factor 4
2lex_A4e-28144214777Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_00064.1_g00049.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4300740.0KF430074.1 Brassica rapa WRKY transcription factor 68 (WRKY68) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018434279.10.0PREDICTED: probable WRKY transcription factor 23
RefseqXP_018434303.10.0PREDICTED: probable WRKY transcription factor 23
SwissprotO229001e-142WRK23_ARATH; WRKY transcription factor 23
TrEMBLA0A0D3BNM50.0A0A0D3BNM5_BRAOL; WRKY transcription factor
TrEMBLA0A3P6C2Q40.0A0A3P6C2Q4_BRAOL; WRKY transcription factor
STRINGBo4g004680.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61522647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.11e-117WRKY DNA-binding protein 23
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Guo D,Qin G
    EXB1/WRKY71 transcription factor regulates both shoot branching and responses to abiotic stresses.
    Plant Signal Behav, 2016. 11(3): p. e1150404
    [PMID:26914912]
  4. PrĂ¡t T, et al.
    WRKY23 is a component of the transcriptional network mediating auxin feedback on PIN polarity.
    PLoS Genet., 2018. 14(1): p. e1007177
    [PMID:29377885]