PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00060.1_g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NF-YA
Protein Properties Length: 336aa    MW: 37659.5 Da    PI: 9.1388
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00060.1_g00008.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA1011.2e-31174228257
                CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGr 57 
                              ep++VNaKQy++I++RRq+Rakle+++kl +k+rkpylheSRh hAl+RpRgsgGr
  Rsa1.0_00060.1_g00008.1 174 EPVFVNAKQYHAIMRRRQQRAKLEAQNKL-IKARKPYLHESRHVHALKRPRGSGGR 228
                              9****************************.*************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005219.0E-37171232IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.812172232IPR001289Nuclear transcription factor Y subunit A
PfamPF020459.0E-26174228IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006166.8E-23175197IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860177197IPR018362CCAAT-binding factor, conserved site
PRINTSPR006166.8E-23206229IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MYQMNKKDST LPYLNTSISW GCTIPTESLG LKVGDARPEH MQTTKKISFQ DLDSPSSQST  60
DQSYSEVVSS GDDKPCRQIS FSTKSDIRLL LYVQFSCHWN VIIALTFLRC LSRTGVSSIH  120
FTPPQANFSF QYADPHIGDL LAATYLPQAP TCSPQMVGMI PGRVPLPVEI TETEPVFVNA  180
KQYHAIMRRR QQRAKLEAQN KLIKARKPYL HESRHVHALK RPRGSGGRIL NTKQLLQESE  240
HAAAKEQEHN KTVQPENKKA NMSRFEAHML QHNKDRGSTT SGSDITSVSD GADIFGHTEF  300
QFSGFPTTQI NRAIHVHGQS NDMHGGGDLH HFSVHI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-18174234363NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013699326.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1
SwissprotQ93ZH21e-173NFYA3_ARATH; Nuclear transcription factor Y subunit A-3
TrEMBLW6D8Q60.0W6D8Q6_BRANA; Transcription factor subunit NF-YA3A.2
STRINGBra003867.1-P1e-172(Brassica rapa)
STRINGBra016031.1-P1e-172(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33492762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.11e-169nuclear factor Y, subunit A3