PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00046.1_g00029.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NF-YA
Protein Properties Length: 116aa    MW: 12991.7 Da    PI: 9.6581
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00046.1_g00029.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA509.6e-161964248
                CBFB_NFYA  2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAl 48
                             ep++VNaKQy++I++RR++ akle+++kl +k+rk    e  h + +
  Rsa1.0_00046.1_g00029.1 19 EPVFVNAKQYHAIMRRREQCAKLEAQNKL-IKGRKAAAKEQEHDKSV 64
                             8****************************.******99998887766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005214.4E-111675IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115216.31777IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.5E-101964IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 116 aa     Download sequence    Send to blast
MVGMVPGRVP LPVEITEAEP VFVNAKQYHA IMRRREQCAK LEAQNKLIKG RKAAAKEQEH  60
DKSVQQANMS RFKAYMLQHN KDRGLTTSGS DITSVSDGAA DIFGHTEFQR FSNNSD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1896078e-63AC189607.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH031P22, complete sequence.
GenBankAC1895078e-63AC189507.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB088E11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013590425.14e-56PREDICTED: nuclear transcription factor Y subunit A-3-like
SwissprotQ93ZH28e-49NFYA3_ARATH; Nuclear transcription factor Y subunit A-3
TrEMBLA0A078C8242e-54A0A078C824_BRANA; BnaC06g33980D protein
TrEMBLA0A0D3D0784e-54A0A0D3D078_BRAOL; Uncharacterized protein
STRINGBra016031.1-P1e-53(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.15e-50nuclear factor Y, subunit A3