PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00046.1_g00028.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NF-YA
Protein Properties Length: 302aa    MW: 33579.6 Da    PI: 9.8526
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00046.1_g00028.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.97.3e-33146201258
                CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                              ep++VNaKQy++I++RRq+Rakle+++kl +k+rkpylheSRh hAl+RpRgsgGrF
  Rsa1.0_00046.1_g00028.1 146 EPVFVNAKQYHAIMRRRQQRAKLEAQNKL-IKARKPYLHESRHVHALKRPRGSGGRF 201
                              9****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.8E-38143204IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.879144204IPR001289Nuclear transcription factor Y subunit A
PfamPF020455.3E-27146201IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006165.4E-24147169IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860149169IPR018362CCAAT-binding factor, conserved site
PRINTSPR006165.4E-24178201IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MSKKGSSLPY LNTSIAWGVL PTEPLNLKTV DARPGHMHTT KQISFQDQDS PSTQSTCQSY  60
TEVASSGDDN PSRQISFSTK SGSEMTSFPN MNFAPTQANF SFHYADPHYG GLLATTYLPQ  120
APTCNPQMVG MVPGRVQLPV EITETEPVFV NAKQYHAIMR RRQQRAKLEA QNKLIKARKP  180
YLHESRHVHA LKRPRGSGGR FLNTKKLLQE SQQAAPKQQE HDKRTNMSRF QAHMLHHNKD  240
RGSTTSGSDI TCVSDGAADI FGHTELQFSG FPTTQTNRAM LVHGQSNDMH GGGDLHHFSV  300
HI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-20146205362NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1896071e-124AC189607.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH031P22, complete sequence.
GenBankAC1895071e-124AC189507.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB088E11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013590425.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like
SwissprotQ93ZH21e-178NFYA3_ARATH; Nuclear transcription factor Y subunit A-3
TrEMBLA0A078C8240.0A0A078C824_BRANA; BnaC06g33980D protein
STRINGBra016031.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33492762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.11e-179nuclear factor Y, subunit A3