PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00045.1_g00051.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WRKY
Protein Properties Length: 382aa    MW: 42568.7 Da    PI: 6.8939
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00045.1_g00051.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.55.5e-33206264159
                              ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                     WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                              ldDgy+WrKYGqK vk+s++prsYYrCt+ gC vkk+vers++dp +v +tYeg+H+h+
  Rsa1.0_00045.1_g00051.1 206 LDDGYRWRKYGQKAVKNSPYPRSYYRCTTVGCGVKKRVERSSDDPYIVMTTYEGQHTHP 264
                              59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.9E-34191266IPR003657WRKY domain
SuperFamilySSF1182908.76E-30198266IPR003657WRKY domain
PROSITE profilePS5081132.73201266IPR003657WRKY domain
SMARTSM007743.2E-39206265IPR003657WRKY domain
PfamPF031061.5E-26207264IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MEQLNSTKNT ETKIQHQEDQ QQQMFQATTS SHMANLDTSS DHHHQLELAG NNINLASIFD  60
APVSSPFPYS YLEDPDPFLD FLPQDHHQFS SSSNSSSFSF DAFPLQNNNT NLFNTDLPLS  120
QPSTKKRASS EVVNIAPTSP SSNSVSSSSK EVANDNIDKD ATLKDPEEGE QEQKGTKPQL  180
KAKKKNQKKA REARVAFLTR SDIDNLDDGY RWRKYGQKAV KNSPYPRSYY RCTTVGCGVK  240
KRVERSSDDP YIVMTTYEGQ HTHPFPMTRG HIAMLTSPIL DHGATATSSS SFAIPPRYLL  300
TQHHQPYSSM YSNSLSMINR SSSDGTFVNP GSSSFPGFGY DMSQASTSTT SAIRDHGLLQ  360
DILPSQIRSD TTNTRTNQED KK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-271992661077Probable WRKY transcription factor 4
2lex_A2e-271992661077Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapRsa1.0_00045.1_g00051.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4300800.0KF430080.1 Brassica rapa WRKY transcription factor 75 (WRKY75) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018454047.10.0PREDICTED: probable WRKY transcription factor 48, partial
SwissprotQ9FGZ41e-146WRK48_ARATH; Probable WRKY transcription factor 48
TrEMBLA0A0D3E0Y50.0A0A0D3E0Y5_BRAOL; Uncharacterized protein
TrEMBLA0A3P6DNT00.0A0A3P6DNT0_BRAOL; Uncharacterized protein
STRINGBo9g009900.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56242648
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49520.11e-127WRKY DNA-binding protein 48
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]